Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 138692..139335 Replicon plasmid pKPC2_130119
Accession NZ_CP127230
Organism Klebsiella pneumoniae strain 130119

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QRA14_RS27650 Protein ID WP_001044770.1
Coordinates 138919..139335 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QRA14_RS27645 Protein ID WP_001261282.1
Coordinates 138692..138922 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA14_RS27610 (133915) 133915..134694 - 780 WP_013214009.1 site-specific integrase -
QRA14_RS27615 (134878) 134878..135882 - 1005 WP_011977814.1 hypothetical protein -
QRA14_RS27620 (135912) 135912..136115 - 204 WP_011977813.1 hypothetical protein -
QRA14_RS27625 (136161) 136161..136682 - 522 WP_013214008.1 hypothetical protein -
QRA14_RS27630 (136740) 136740..137132 - 393 WP_011977811.1 hypothetical protein -
QRA14_RS27635 (137169) 137169..138113 - 945 WP_011977810.1 hypothetical protein -
QRA14_RS27640 (138274) 138274..138735 - 462 WP_014343465.1 hypothetical protein -
QRA14_RS27645 (138692) 138692..138922 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRA14_RS27650 (138919) 138919..139335 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QRA14_RS27655 (139409) 139409..140971 + 1563 WP_004206609.1 AAA family ATPase -
QRA14_RS27660 (140956) 140956..141978 + 1023 WP_000361404.1 helicase UvrD -
QRA14_RS27665 (142234) 142234..142931 + 698 WP_223174630.1 IS1 family transposase -
QRA14_RS27670 (142960) 142960..143232 + 273 Protein_196 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..153000 153000


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T283649 WP_001044770.1 NZ_CP127230:138919-139335 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT283649 WP_001261282.1 NZ_CP127230:138692-138922 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References