Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 138692..139335 | Replicon | plasmid pKPC2_130119 |
Accession | NZ_CP127230 | ||
Organism | Klebsiella pneumoniae strain 130119 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | QRA14_RS27650 | Protein ID | WP_001044770.1 |
Coordinates | 138919..139335 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | QRA14_RS27645 | Protein ID | WP_001261282.1 |
Coordinates | 138692..138922 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA14_RS27610 (133915) | 133915..134694 | - | 780 | WP_013214009.1 | site-specific integrase | - |
QRA14_RS27615 (134878) | 134878..135882 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
QRA14_RS27620 (135912) | 135912..136115 | - | 204 | WP_011977813.1 | hypothetical protein | - |
QRA14_RS27625 (136161) | 136161..136682 | - | 522 | WP_013214008.1 | hypothetical protein | - |
QRA14_RS27630 (136740) | 136740..137132 | - | 393 | WP_011977811.1 | hypothetical protein | - |
QRA14_RS27635 (137169) | 137169..138113 | - | 945 | WP_011977810.1 | hypothetical protein | - |
QRA14_RS27640 (138274) | 138274..138735 | - | 462 | WP_014343465.1 | hypothetical protein | - |
QRA14_RS27645 (138692) | 138692..138922 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRA14_RS27650 (138919) | 138919..139335 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRA14_RS27655 (139409) | 139409..140971 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
QRA14_RS27660 (140956) | 140956..141978 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
QRA14_RS27665 (142234) | 142234..142931 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
QRA14_RS27670 (142960) | 142960..143232 | + | 273 | Protein_196 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..153000 | 153000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T283649 WP_001044770.1 NZ_CP127230:138919-139335 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |