Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1032167..1032786 Replicon chromosome
Accession NZ_CP127229
Organism Klebsiella pneumoniae strain 130119

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QRA14_RS05040 Protein ID WP_002892050.1
Coordinates 1032568..1032786 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QRA14_RS05035 Protein ID WP_002892066.1
Coordinates 1032167..1032541 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA14_RS05025 (QRA14_05025) 1027319..1028512 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QRA14_RS05030 (QRA14_05030) 1028535..1031681 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QRA14_RS05035 (QRA14_05035) 1032167..1032541 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QRA14_RS05040 (QRA14_05040) 1032568..1032786 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QRA14_RS05045 (QRA14_05045) 1032945..1033511 + 567 WP_002892030.1 maltose O-acetyltransferase -
QRA14_RS05050 (QRA14_05050) 1033483..1033623 - 141 WP_004147370.1 hypothetical protein -
QRA14_RS05055 (QRA14_05055) 1033644..1034114 + 471 WP_002892026.1 YlaC family protein -
QRA14_RS05060 (QRA14_05060) 1034089..1035540 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QRA14_RS05065 (QRA14_05065) 1035641..1036339 + 699 WP_002892021.1 GNAT family protein -
QRA14_RS05070 (QRA14_05070) 1036336..1036476 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QRA14_RS05075 (QRA14_05075) 1036476..1036739 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T283633 WP_002892050.1 NZ_CP127229:1032568-1032786 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT283633 WP_002892066.1 NZ_CP127229:1032167-1032541 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References