Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5355802..5356429 | Replicon | chromosome |
Accession | NZ_CP127228 | ||
Organism | Pseudomonas tohonis strain KRS022 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | QQ016_RS23910 | Protein ID | WP_263151077.1 |
Coordinates | 5355802..5355984 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QQ016_RS23915 | Protein ID | WP_263151076.1 |
Coordinates | 5356022..5356429 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ016_RS23885 | 5351821..5352582 | + | 762 | WP_111263764.1 | amino acid ABC transporter ATP-binding protein | - |
QQ016_RS23890 | 5353034..5353987 | - | 954 | WP_285960856.1 | helix-turn-helix domain-containing protein | - |
QQ016_RS23895 | 5354104..5354574 | + | 471 | WP_285960857.1 | nuclear transport factor 2 family protein | - |
QQ016_RS23900 | 5354656..5355354 | + | 699 | WP_271103913.1 | glutathione S-transferase family protein | - |
QQ016_RS23905 | 5355351..5355659 | + | 309 | WP_263151078.1 | GIY-YIG nuclease family protein | - |
QQ016_RS23910 | 5355802..5355984 | + | 183 | WP_263151077.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QQ016_RS23915 | 5356022..5356429 | + | 408 | WP_263151076.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QQ016_RS23920 | 5356592..5357527 | + | 936 | WP_285960858.1 | glutathione S-transferase family protein | - |
QQ016_RS23925 | 5357585..5358592 | - | 1008 | WP_271103910.1 | nucleoid-associated protein YejK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6841.90 Da Isoelectric Point: 10.5627
>T283630 WP_263151077.1 NZ_CP127228:5355802-5355984 [Pseudomonas tohonis]
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14523.38 Da Isoelectric Point: 4.3759
>AT283630 WP_263151076.1 NZ_CP127228:5356022-5356429 [Pseudomonas tohonis]
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|