Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 4178885..4179468 | Replicon | chromosome |
Accession | NZ_CP127228 | ||
Organism | Pseudomonas tohonis strain KRS022 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQ016_RS18875 | Protein ID | WP_285960433.1 |
Coordinates | 4178885..4179265 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QQ016_RS18880 | Protein ID | WP_285960434.1 |
Coordinates | 4179268..4179468 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ016_RS18860 | 4174964..4176379 | + | 1416 | WP_213627339.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
QQ016_RS18865 | 4176396..4178216 | + | 1821 | WP_173178174.1 | sodium-extruding oxaloacetate decarboxylase subunit alpha | - |
QQ016_RS18870 | 4178379..4178819 | + | 441 | WP_173178175.1 | CBS domain-containing protein | - |
QQ016_RS18875 | 4178885..4179265 | - | 381 | WP_285960433.1 | PIN domain-containing protein | Toxin |
QQ016_RS18880 | 4179268..4179468 | - | 201 | WP_285960434.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QQ016_RS18885 | 4179700..4180689 | - | 990 | WP_285960435.1 | asparaginase | - |
QQ016_RS18890 | 4180850..4182298 | - | 1449 | WP_285960436.1 | alanine/glycine:cation symporter family protein | - |
QQ016_RS18895 | 4182467..4183285 | + | 819 | WP_173178179.1 | helix-turn-helix transcriptional regulator | - |
QQ016_RS18900 | 4183341..4184033 | + | 693 | WP_271104329.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13905.16 Da Isoelectric Point: 6.6301
>T283629 WP_285960433.1 NZ_CP127228:c4179265-4178885 [Pseudomonas tohonis]
MSVLVDTSVWIDHFRNGNEELVRLIGQDQVLVHPLVIGEIACGTPPAPRAETLRNLSLLLPCTQATLAEVMAFIEREQLY
GLGCGWVDLTLLASTLMTPGARLWTLDRRLAQLAGRFGVAHHPSRH
MSVLVDTSVWIDHFRNGNEELVRLIGQDQVLVHPLVIGEIACGTPPAPRAETLRNLSLLLPCTQATLAEVMAFIEREQLY
GLGCGWVDLTLLASTLMTPGARLWTLDRRLAQLAGRFGVAHHPSRH
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|