Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 285706..286339 | Replicon | chromosome |
| Accession | NZ_CP127228 | ||
| Organism | Pseudomonas tohonis strain KRS022 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQ016_RS01370 | Protein ID | WP_285961366.1 |
| Coordinates | 285968..286339 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QQ016_RS01365 | Protein ID | WP_285961365.1 |
| Coordinates | 285706..285942 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ016_RS01340 | 281452..281808 | - | 357 | WP_173180260.1 | hydroxyisourate hydrolase | - |
| QQ016_RS01345 | 281805..282311 | - | 507 | WP_285961361.1 | nucleoside deaminase | - |
| QQ016_RS01350 | 282351..283688 | - | 1338 | WP_285961362.1 | nucleobase:cation symporter-2 family protein | - |
| QQ016_RS01355 | 283847..284761 | + | 915 | WP_285961363.1 | LysR family transcriptional regulator | - |
| QQ016_RS01360 | 284934..285566 | - | 633 | WP_285961364.1 | hypothetical protein | - |
| QQ016_RS01365 | 285706..285942 | + | 237 | WP_285961365.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QQ016_RS01370 | 285968..286339 | + | 372 | WP_285961366.1 | PIN domain-containing protein | Toxin |
| QQ016_RS01375 | 286348..287115 | - | 768 | WP_285961367.1 | DUF2092 domain-containing protein | - |
| QQ016_RS01380 | 287240..288136 | + | 897 | WP_285961368.1 | alpha/beta hydrolase | - |
| QQ016_RS01385 | 288210..288806 | + | 597 | WP_263150039.1 | chalcone isomerase family protein | - |
| QQ016_RS01390 | 288814..289278 | - | 465 | WP_285961369.1 | DoxX family protein | - |
| QQ016_RS01395 | 289292..290077 | - | 786 | WP_285961370.1 | DNA-binding domain-containing protein | - |
| QQ016_RS01400 | 290074..290913 | - | 840 | WP_285961371.1 | DUF692 domain-containing protein | - |
| QQ016_RS01405 | 290930..291202 | - | 273 | WP_021217973.1 | DUF2282 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13568.81 Da Isoelectric Point: 7.1892
>T283627 WP_285961366.1 NZ_CP127228:285968-286339 [Pseudomonas tohonis]
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLIDGRLRVLNPFG
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLIDGRLRVLNPFG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|