Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1381796..1382715 | Replicon | chromosome |
Accession | NZ_CP127223 | ||
Organism | Bacillus licheniformis strain Jrh14-10 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | T5HIF3 |
Locus tag | QQ984_RS07095 | Protein ID | WP_003180879.1 |
Coordinates | 1381969..1382715 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | T5HT37 |
Locus tag | QQ984_RS07090 | Protein ID | WP_003180877.1 |
Coordinates | 1381796..1381969 (-) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ984_RS07065 (QQ984_07065) | 1377221..1378318 | + | 1098 | WP_003180867.1 | mannonate dehydratase | - |
QQ984_RS07070 (QQ984_07070) | 1378294..1379142 | + | 849 | WP_003180869.1 | SDR family oxidoreductase | - |
QQ984_RS07075 (QQ984_07075) | 1379169..1380182 | + | 1014 | WP_011197810.1 | zinc-binding alcohol dehydrogenase family protein | - |
QQ984_RS07080 (QQ984_07080) | 1380235..1381506 | + | 1272 | WP_009328725.1 | MFS transporter | - |
QQ984_RS07085 (QQ984_07085) | 1381569..1381700 | - | 132 | WP_003180875.1 | hypothetical protein | - |
QQ984_RS07090 (QQ984_07090) | 1381796..1381969 | - | 174 | WP_003180877.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QQ984_RS07095 (QQ984_07095) | 1381969..1382715 | - | 747 | WP_003180879.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QQ984_RS07100 (QQ984_07100) | 1382826..1383824 | - | 999 | WP_009328723.1 | inorganic phosphate transporter | - |
QQ984_RS07105 (QQ984_07105) | 1383837..1384454 | - | 618 | WP_003180884.1 | DUF47 domain-containing protein | - |
QQ984_RS07110 (QQ984_07110) | 1384786..1386543 | + | 1758 | WP_011197813.1 | gamma-glutamyltransferase | - |
QQ984_RS07115 (QQ984_07115) | 1386672..1387315 | + | 644 | Protein_1348 | DUF624 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29391.80 Da Isoelectric Point: 4.5367
>T283624 WP_003180879.1 NZ_CP127223:c1382715-1381969 [Bacillus licheniformis]
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
MLLFYQFLVWLIVLALALYVAAVWRFEKQLAEKTVAIRKTWYLLYVIGAVIYWTHDPQSIFTNPLHYLIVAVFFTLTDAF
IFLNAYFKKLGSSELATDTRMLLEENNDLLHTYQNRLKTFQYLLKNEPIHIYYGNIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSEESKDHLLEHMENRFDVQEKLDRKDVYYEENGKMVLIPFSIHDFDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDD
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|