Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 556720..557356 | Replicon | chromosome |
| Accession | NZ_CP127223 | ||
| Organism | Bacillus licheniformis strain Jrh14-10 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | QQ984_RS02775 | Protein ID | WP_003179128.1 |
| Coordinates | 557006..557356 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | QQ984_RS02770 | Protein ID | WP_006638778.1 |
| Coordinates | 556720..557001 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ984_RS02750 (QQ984_02750) | 551835..553316 | + | 1482 | WP_009330132.1 | PH domain-containing protein | - |
| QQ984_RS02755 (QQ984_02755) | 553313..553912 | - | 600 | WP_003179118.1 | rhomboid family intramembrane serine protease | - |
| QQ984_RS02760 (QQ984_02760) | 554255..555214 | + | 960 | WP_154495823.1 | outer membrane lipoprotein carrier protein LolA | - |
| QQ984_RS02765 (QQ984_02765) | 555439..556608 | + | 1170 | WP_026080763.1 | alanine racemase | - |
| QQ984_RS02770 (QQ984_02770) | 556720..557001 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| QQ984_RS02775 (QQ984_02775) | 557006..557356 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QQ984_RS02780 (QQ984_02780) | 557474..558301 | + | 828 | WP_061578564.1 | RsbT co-antagonist protein RsbRA | - |
| QQ984_RS02785 (QQ984_02785) | 558305..558670 | + | 366 | WP_003179132.1 | STAS domain-containing protein | - |
| QQ984_RS02790 (QQ984_02790) | 558673..559074 | + | 402 | WP_003179135.1 | anti-sigma regulatory factor | - |
| QQ984_RS02795 (QQ984_02795) | 559085..560092 | + | 1008 | WP_003179137.1 | PP2C family protein-serine/threonine phosphatase | - |
| QQ984_RS02800 (QQ984_02800) | 560151..560477 | + | 327 | WP_003179140.1 | anti-sigma factor antagonist | - |
| QQ984_RS02805 (QQ984_02805) | 560477..560962 | + | 486 | WP_003179142.1 | anti-sigma B factor RsbW | - |
| QQ984_RS02810 (QQ984_02810) | 560928..561719 | + | 792 | WP_003179144.1 | RNA polymerase sigma factor SigB | - |
| QQ984_RS02815 (QQ984_02815) | 561716..562315 | + | 600 | WP_003179145.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T283623 WP_003179128.1 NZ_CP127223:557006-557356 [Bacillus licheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |