Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 86150..87287 | Replicon | plasmid p90_2023_A |
Accession | NZ_CP127178 | ||
Organism | Enterococcus faecalis strain 90_2023 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | QQS48_RS13550 | Protein ID | WP_002332783.1 |
Coordinates | 86150..87013 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QQS48_RS13555 | Protein ID | WP_002326825.1 |
Coordinates | 87015..87287 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS48_RS13505 (QQS48_13505) | 81392..81502 | - | 111 | Protein_95 | aminoglycoside 6-adenylyltransferase | - |
QQS48_RS13510 (QQS48_13510) | 81521..81637 | - | 117 | Protein_96 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
QQS48_RS13515 (QQS48_13515) | 81807..82544 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QQS48_RS13520 (QQS48_13520) | 82669..82752 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
QQS48_RS13525 (QQS48_13525) | 82801..83040 | - | 240 | WP_000635249.1 | peptide-binding protein | - |
QQS48_RS13530 (QQS48_13530) | 83174..83800 | - | 627 | Protein_100 | DNA topoisomerase | - |
QQS48_RS13535 (QQS48_13535) | 83876..84556 | + | 681 | WP_010717201.1 | IS6-like element IS1216 family transposase | - |
QQS48_RS13540 (QQS48_13540) | 84590..85096 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
QQS48_RS13545 (QQS48_13545) | 85393..85710 | - | 318 | WP_002326830.1 | hypothetical protein | - |
QQS48_RS13550 (QQS48_13550) | 86150..87013 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
QQS48_RS13555 (QQS48_13555) | 87015..87287 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QQS48_RS13560 (QQS48_13560) | 87305..87520 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
QQS48_RS13565 (QQS48_13565) | 87612..88508 | - | 897 | WP_002326827.1 | ParA family protein | - |
QQS48_RS13570 (QQS48_13570) | 88611..88871 | - | 261 | Protein_108 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
QQS48_RS13575 (QQS48_13575) | 89041..89778 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QQS48_RS13580 (QQS48_13580) | 89903..89986 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
QQS48_RS13585 (QQS48_13585) | 90035..90118 | - | 84 | Protein_111 | MLS leader peptide | - |
QQS48_RS13590 (QQS48_13590) | 90418..90789 | - | 372 | WP_002358205.1 | hypothetical protein | - |
QQS48_RS13595 (QQS48_13595) | 90782..91627 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..92098 | 92098 | |
- | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 65370..89778 | 24408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T283621 WP_002332783.1 NZ_CP127178:c87013-86150 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |