Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 69939..71047 | Replicon | plasmid p90_2023_A |
Accession | NZ_CP127178 | ||
Organism | Enterococcus faecalis strain 90_2023 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | - |
Locus tag | QQS48_RS13440 | Protein ID | WP_078126936.1 |
Coordinates | 69939..70808 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | B9DSK1 |
Locus tag | QQS48_RS13445 | Protein ID | WP_002303393.1 |
Coordinates | 70823..71047 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS48_RS13405 (QQS48_13405) | 65370..66107 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QQS48_RS13410 (QQS48_13410) | 66232..66315 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
QQS48_RS13415 (QQS48_13415) | 66364..66447 | - | 84 | Protein_77 | MLS leader peptide | - |
QQS48_RS13420 (QQS48_13420) | 66857..67651 | - | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
QQS48_RS13425 (QQS48_13425) | 67744..68286 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
QQS48_RS13430 (QQS48_13430) | 68283..69191 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
QQS48_RS13435 (QQS48_13435) | 69224..69958 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
QQS48_RS13440 (QQS48_13440) | 69939..70808 | - | 870 | WP_078126936.1 | nucleotidyltransferase domain-containing protein | Toxin |
QQS48_RS13445 (QQS48_13445) | 70823..71047 | - | 225 | WP_002303393.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QQS48_RS13450 (QQS48_13450) | 71190..72011 | - | 822 | Protein_84 | recombinase zinc beta ribbon domain-containing protein | - |
QQS48_RS13455 (QQS48_13455) | 72699..73502 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
QQS48_RS13460 (QQS48_13460) | 73556..75040 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
QQS48_RS13465 (QQS48_13465) | 75483..76046 | - | 564 | Protein_87 | recombinase zinc beta ribbon domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..92098 | 92098 | |
- | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 65370..89778 | 24408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32835.43 Da Isoelectric Point: 4.7269
>T283620 WP_078126936.1 NZ_CP127178:c70808-69939 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|