283619

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 58763..59334 Replicon plasmid p90_2023_A
Accession NZ_CP127178
Organism Enterococcus faecalis strain 90_2023

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag QQS48_RS13335 Protein ID WP_002362432.1
Coordinates 58763..59104 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag QQS48_RS13340 Protein ID WP_002362431.1
Coordinates 59104..59334 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQS48_RS13310 (QQS48_13310) 53780..54472 - 693 WP_033918847.1 Fic family protein -
QQS48_RS13315 (QQS48_13315) 54521..55120 - 600 WP_008382128.1 tyrosine-type recombinase/integrase -
QQS48_RS13325 (QQS48_13325) 56846..57448 - 603 WP_002362434.1 Fic family protein -
QQS48_RS13330 (QQS48_13330) 57713..58651 - 939 WP_002362433.1 hypothetical protein -
QQS48_RS13335 (QQS48_13335) 58763..59104 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QQS48_RS13340 (QQS48_13340) 59104..59334 - 231 WP_002362431.1 hypothetical protein Antitoxin
QQS48_RS13345 (QQS48_13345) 59538..60158 + 621 WP_002367784.1 recombinase family protein -
QQS48_RS13350 (QQS48_13350) 60148..60462 + 315 WP_002367785.1 hypothetical protein -
QQS48_RS13355 (QQS48_13355) 60456..60662 + 207 WP_002367786.1 hypothetical protein -
QQS48_RS13360 (QQS48_13360) 60822..61016 + 195 WP_002367787.1 hypothetical protein -
QQS48_RS13365 (QQS48_13365) 61028..61219 + 192 WP_002367788.1 hypothetical protein -
QQS48_RS13370 (QQS48_13370) 61389..61604 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
QQS48_RS13375 (QQS48_13375) 61605..61946 + 342 WP_002367792.1 bacteriocin immunity protein -
QQS48_RS13380 (QQS48_13380) 62362..62880 + 519 WP_002367793.1 hypothetical protein -
QQS48_RS13385 (QQS48_13385) 62828..63043 + 216 WP_002415356.1 hypothetical protein -
QQS48_RS13390 (QQS48_13390) 63135..63221 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
QQS48_RS13395 (QQS48_13395) 63478..63774 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..92098 92098


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T283619 WP_002362432.1 NZ_CP127178:c59104-58763 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT283619 WP_002362431.1 NZ_CP127178:c59334-59104 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References