Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1720877..1721562 | Replicon | chromosome |
| Accession | NZ_CP127177 | ||
| Organism | Enterococcus faecalis strain 90_2023 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QQS48_RS08315 | Protein ID | WP_267570856.1 |
| Coordinates | 1721218..1721562 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QQS48_RS08310 | Protein ID | WP_010826721.1 |
| Coordinates | 1720877..1721200 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQS48_RS08255 (1716204) | 1716204..1717142 | - | 939 | WP_002410850.1 | DUF1351 domain-containing protein | - |
| QQS48_RS08260 (1717127) | 1717127..1717804 | - | 678 | WP_002389124.1 | ERF family protein | - |
| QQS48_RS08265 (1717805) | 1717805..1718041 | - | 237 | WP_002389004.1 | hypothetical protein | - |
| QQS48_RS08270 (1718098) | 1718098..1718253 | - | 156 | WP_002389151.1 | hypothetical protein | - |
| QQS48_RS08275 (1718418) | 1718418..1718603 | + | 186 | WP_025188165.1 | DUF1508 domain-containing protein | - |
| QQS48_RS08280 (1718768) | 1718768..1718908 | - | 141 | WP_280196304.1 | hypothetical protein | - |
| QQS48_RS08285 (1718920) | 1718920..1719111 | - | 192 | WP_236547317.1 | hypothetical protein | - |
| QQS48_RS08290 (1719122) | 1719122..1719307 | - | 186 | WP_033598023.1 | hypothetical protein | - |
| QQS48_RS08295 (1719318) | 1719318..1720031 | - | 714 | WP_267570857.1 | Rha family transcriptional regulator | - |
| QQS48_RS08300 (1720070) | 1720070..1720381 | - | 312 | WP_280196303.1 | hypothetical protein | - |
| QQS48_RS08305 (1720392) | 1720392..1720568 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QQS48_RS08310 (1720877) | 1720877..1721200 | + | 324 | WP_010826721.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QQS48_RS08315 (1721218) | 1721218..1721562 | + | 345 | WP_267570856.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QQS48_RS08320 (1721596) | 1721596..1722324 | + | 729 | WP_126266796.1 | potassium channel family protein | - |
| QQS48_RS08325 (1722424) | 1722424..1723572 | + | 1149 | WP_010711674.1 | site-specific integrase | - |
| QQS48_RS08330 (1723609) | 1723609..1724043 | - | 435 | Protein_1610 | competence type IV pilus minor pilin ComGD | - |
| QQS48_RS08335 (1724040) | 1724040..1724315 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| QQS48_RS08340 (1724315) | 1724315..1725361 | - | 1047 | WP_033786346.1 | competence type IV pilus assembly protein ComGB | - |
| QQS48_RS08345 (1725321) | 1725321..1726286 | - | 966 | WP_280196293.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1685066..1724016 | 38950 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13734.69 Da Isoelectric Point: 6.1363
>T283611 WP_267570856.1 NZ_CP127177:1721218-1721562 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMESEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLK
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMESEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|