283611

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1720877..1721562 Replicon chromosome
Accession NZ_CP127177
Organism Enterococcus faecalis strain 90_2023

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag QQS48_RS08315 Protein ID WP_267570856.1
Coordinates 1721218..1721562 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QQS48_RS08310 Protein ID WP_010826721.1
Coordinates 1720877..1721200 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQS48_RS08255 (1716204) 1716204..1717142 - 939 WP_002410850.1 DUF1351 domain-containing protein -
QQS48_RS08260 (1717127) 1717127..1717804 - 678 WP_002389124.1 ERF family protein -
QQS48_RS08265 (1717805) 1717805..1718041 - 237 WP_002389004.1 hypothetical protein -
QQS48_RS08270 (1718098) 1718098..1718253 - 156 WP_002389151.1 hypothetical protein -
QQS48_RS08275 (1718418) 1718418..1718603 + 186 WP_025188165.1 DUF1508 domain-containing protein -
QQS48_RS08280 (1718768) 1718768..1718908 - 141 WP_280196304.1 hypothetical protein -
QQS48_RS08285 (1718920) 1718920..1719111 - 192 WP_236547317.1 hypothetical protein -
QQS48_RS08290 (1719122) 1719122..1719307 - 186 WP_033598023.1 hypothetical protein -
QQS48_RS08295 (1719318) 1719318..1720031 - 714 WP_267570857.1 Rha family transcriptional regulator -
QQS48_RS08300 (1720070) 1720070..1720381 - 312 WP_280196303.1 hypothetical protein -
QQS48_RS08305 (1720392) 1720392..1720568 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
QQS48_RS08310 (1720877) 1720877..1721200 + 324 WP_010826721.1 helix-turn-helix transcriptional regulator Antitoxin
QQS48_RS08315 (1721218) 1721218..1721562 + 345 WP_267570856.1 ImmA/IrrE family metallo-endopeptidase Toxin
QQS48_RS08320 (1721596) 1721596..1722324 + 729 WP_126266796.1 potassium channel family protein -
QQS48_RS08325 (1722424) 1722424..1723572 + 1149 WP_010711674.1 site-specific integrase -
QQS48_RS08330 (1723609) 1723609..1724043 - 435 Protein_1610 competence type IV pilus minor pilin ComGD -
QQS48_RS08335 (1724040) 1724040..1724315 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QQS48_RS08340 (1724315) 1724315..1725361 - 1047 WP_033786346.1 competence type IV pilus assembly protein ComGB -
QQS48_RS08345 (1725321) 1725321..1726286 - 966 WP_280196293.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1685066..1724016 38950


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-80)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-59)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13734.69 Da        Isoelectric Point: 6.1363

>T283611 WP_267570856.1 NZ_CP127177:1721218-1721562 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMESEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12330.96 Da        Isoelectric Point: 5.2520

>AT283611 WP_010826721.1 NZ_CP127177:1720877-1721200 [Enterococcus faecalis]
MTVFDRVKKLADSQKISIVELEEKLNFSRNSLYAWKKSKPSIDKLEAVANYFGVSTDYLLGREISNKPKQSDDLDEILDN
VMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References