Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1124444..1125079 | Replicon | chromosome |
| Accession | NZ_CP127162 | ||
| Organism | Paenibacillus sp. C31 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QPK24_RS05345 | Protein ID | WP_160032284.1 |
| Coordinates | 1124729..1125079 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QPK24_RS05340 | Protein ID | WP_160032285.1 |
| Coordinates | 1124444..1124725 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPK24_RS05325 (QPK24_05325) | 1120872..1121435 | + | 564 | WP_285746797.1 | GbsR/MarR family transcriptional regulator | - |
| QPK24_RS05330 (QPK24_05330) | 1121611..1122792 | + | 1182 | WP_285746799.1 | outer membrane lipoprotein carrier protein LolA | - |
| QPK24_RS05335 (QPK24_05335) | 1123042..1124223 | + | 1182 | WP_285746802.1 | alanine racemase | - |
| QPK24_RS05340 (QPK24_05340) | 1124444..1124725 | + | 282 | WP_160032285.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QPK24_RS05345 (QPK24_05345) | 1124729..1125079 | + | 351 | WP_160032284.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QPK24_RS05350 (QPK24_05350) | 1125314..1127503 | + | 2190 | WP_285746804.1 | alpha-galactosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12824.75 Da Isoelectric Point: 4.8502
>T283604 WP_160032284.1 NZ_CP127162:1124729-1125079 [Paenibacillus sp. C31]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAEAHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDETMKLVNESLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAEAHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDETMKLVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|