Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1460200..1460828 | Replicon | chromosome |
Accession | NZ_CP127161 | ||
Organism | Proteiniborus sp. MB09-C3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QO263_RS07045 | Protein ID | WP_285629230.1 |
Coordinates | 1460478..1460828 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QO263_RS07040 | Protein ID | WP_285628093.1 |
Coordinates | 1460200..1460481 (+) | Length | 94 a.a. |
Genomic Context
Location: 1455720..1456328 (609 bp)
Type: Others
Protein ID: WP_285628079.1
Type: Others
Protein ID: WP_285628079.1
Location: 1456442..1456708 (267 bp)
Type: Others
Protein ID: WP_285628082.1
Type: Others
Protein ID: WP_285628082.1
Location: 1456743..1458038 (1296 bp)
Type: Others
Protein ID: WP_285628085.1
Type: Others
Protein ID: WP_285628085.1
Location: 1458068..1458721 (654 bp)
Type: Others
Protein ID: WP_285628088.1
Type: Others
Protein ID: WP_285628088.1
Location: 1458869..1460041 (1173 bp)
Type: Others
Protein ID: WP_285628091.1
Type: Others
Protein ID: WP_285628091.1
Location: 1460200..1460481 (282 bp)
Type: Antitoxin
Protein ID: WP_285628093.1
Type: Antitoxin
Protein ID: WP_285628093.1
Location: 1460478..1460828 (351 bp)
Type: Toxin
Protein ID: WP_285629230.1
Type: Toxin
Protein ID: WP_285629230.1
Location: 1461058..1461606 (549 bp)
Type: Others
Protein ID: WP_285628096.1
Type: Others
Protein ID: WP_285628096.1
Location: 1461715..1462803 (1089 bp)
Type: Others
Protein ID: WP_285628099.1
Type: Others
Protein ID: WP_285628099.1
Location: 1462865..1464004 (1140 bp)
Type: Others
Protein ID: WP_285628102.1
Type: Others
Protein ID: WP_285628102.1
Location: 1463994..1464455 (462 bp)
Type: Others
Protein ID: WP_285628105.1
Type: Others
Protein ID: WP_285628105.1
Location: 1464472..1464963 (492 bp)
Type: Others
Protein ID: WP_285628108.1
Type: Others
Protein ID: WP_285628108.1
Location: 1464968..1465510 (543 bp)
Type: Others
Protein ID: WP_285628110.1
Type: Others
Protein ID: WP_285628110.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO263_RS07015 (QO263_07015) | 1455720..1456328 | + | 609 | WP_285628079.1 | hypothetical protein | - |
QO263_RS07020 (QO263_07020) | 1456442..1456708 | + | 267 | WP_285628082.1 | hypothetical protein | - |
QO263_RS07025 (QO263_07025) | 1456743..1458038 | + | 1296 | WP_285628085.1 | NAD(P)H-hydrate dehydratase | - |
QO263_RS07030 (QO263_07030) | 1458068..1458721 | + | 654 | WP_285628088.1 | outer membrane lipoprotein-sorting protein | - |
QO263_RS07035 (QO263_07035) | 1458869..1460041 | + | 1173 | WP_285628091.1 | alanine racemase | - |
QO263_RS07040 (QO263_07040) | 1460200..1460481 | + | 282 | WP_285628093.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QO263_RS07045 (QO263_07045) | 1460478..1460828 | + | 351 | WP_285629230.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QO263_RS07050 (QO263_07050) | 1461058..1461606 | + | 549 | WP_285628096.1 | hypothetical protein | - |
QO263_RS07055 (QO263_07055) | 1461715..1462803 | + | 1089 | WP_285628099.1 | glycosyltransferase | - |
QO263_RS07060 (QO263_07060) | 1462865..1464004 | + | 1140 | WP_285628102.1 | glycosyltransferase family 4 protein | - |
QO263_RS07065 (QO263_07065) | 1463994..1464455 | + | 462 | WP_285628105.1 | DUF4330 domain-containing protein | - |
QO263_RS07070 (QO263_07070) | 1464472..1464963 | + | 492 | WP_285628108.1 | DUF4330 domain-containing protein | - |
QO263_RS07075 (QO263_07075) | 1464968..1465510 | + | 543 | WP_285628110.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12830.92 Da Isoelectric Point: 6.4646
>T283603 WP_285629230.1 NZ_CP127161:1460478-1460828 [Proteiniborus sp. MB09-C3]
VIVKRGDILYADLSPVIGSEQGGVRPVLVIQNDIGNKYSPTVIISAITSQINKAKLPTHIEITAPEYGLPKDSVVLLEQI
RTIDKKRLREKIGHFDDDMMAKVDECLKISIGLSDY
VIVKRGDILYADLSPVIGSEQGGVRPVLVIQNDIGNKYSPTVIISAITSQINKAKLPTHIEITAPEYGLPKDSVVLLEQI
RTIDKKRLREKIGHFDDDMMAKVDECLKISIGLSDY
Download Length: 351 bp