Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 777046..778154 | Replicon | chromosome |
| Accession | NZ_CP127160 | ||
| Organism | Enterococcus sp. FZMF | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | QN079_RS03790 | Protein ID | WP_000233000.1 |
| Coordinates | 777285..778154 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | QN079_RS03785 | Protein ID | WP_000205227.1 |
| Coordinates | 777046..777270 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN079_RS03765 (QN079_03765) | 773374..773907 | + | 534 | WP_289230397.1 | GrpB family protein | - |
| QN079_RS03770 (QN079_03770) | 773941..774388 | + | 448 | Protein_746 | CatB-related O-acetyltransferase | - |
| QN079_RS03775 (QN079_03775) | 774704..775456 | + | 753 | WP_289230398.1 | hypothetical protein | - |
| QN079_RS03780 (QN079_03780) | 776181..776903 | + | 723 | Protein_748 | zinc ribbon domain-containing protein | - |
| QN079_RS03785 (QN079_03785) | 777046..777270 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QN079_RS03790 (QN079_03790) | 777285..778154 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| QN079_RS03795 (QN079_03795) | 778135..778869 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| QN079_RS03800 (QN079_03800) | 778902..779765 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| QN079_RS03805 (QN079_03805) | 779852..781042 | - | 1191 | WP_289230399.1 | IS256-like element ISLgar5 family transposase | - |
| QN079_RS03810 (QN079_03810) | 781153..781680 | + | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T283601 WP_000233000.1 NZ_CP127160:777285-778154 [Enterococcus sp. FZMF]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|