Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 661..1135 | Replicon | plasmid pT1_p5 |
Accession | NZ_CP127158 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain T1 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | A0A8J3DT22 |
Locus tag | QP513_RS29985 | Protein ID | WP_004197762.1 |
Coordinates | 869..1135 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | S1EJF5 |
Locus tag | QP513_RS29980 | Protein ID | WP_000879771.1 |
Coordinates | 661..885 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP513_RS29980 (QP513_29980) | 661..885 | + | 225 | WP_000879771.1 | DUF6290 family protein | Antitoxin |
QP513_RS29985 (QP513_29985) | 869..1135 | + | 267 | WP_004197762.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP513_RS29990 (QP513_29990) | 1205..1555 | - | 351 | WP_149795812.1 | hypothetical protein | - |
QP513_RS29995 (QP513_29995) | 1621..2166 | - | 546 | WP_023317533.1 | hypothetical protein | - |
QP513_RS30000 (QP513_30000) | 2192..2518 | - | 327 | WP_050516389.1 | hypothetical protein | - |
QP513_RS30005 (QP513_30005) | 3674..3850 | + | 177 | WP_004197757.1 | hypothetical protein | - |
QP513_RS30010 (QP513_30010) | 3840..4184 | + | 345 | WP_062955149.1 | MobC family plasmid mobilization relaxosome protein | - |
QP513_RS30015 (QP513_30015) | 4393..4827 | + | 435 | Protein_7 | relaxase/mobilization nuclease domain-containing protein | - |
QP513_RS30020 (QP513_30020) | 4862..5371 | + | 510 | WP_032433972.1 | MbeB family mobilization protein | - |
QP513_RS30025 (QP513_30025) | 5378..5590 | + | 213 | WP_021527181.1 | MbeD family mobilization/exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..5596 | 5596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10342.96 Da Isoelectric Point: 9.8727
>T283599 WP_004197762.1 NZ_CP127158:869-1135 [Klebsiella pneumoniae subsp. pneumoniae]
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|