Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3418..3998 | Replicon | plasmid pT1_p4 |
Accession | NZ_CP127157 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain T1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | QP513_RS29935 | Protein ID | WP_071177730.1 |
Coordinates | 3418..3732 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | QP513_RS29940 | Protein ID | WP_000093040.1 |
Coordinates | 3720..3998 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP513_RS29915 (QP513_29915) | 1326..2057 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
QP513_RS29920 (QP513_29920) | 2064..2594 | + | 531 | WP_071177729.1 | hypothetical protein | - |
QP513_RS29925 (QP513_29925) | 2621..2800 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
QP513_RS29930 (QP513_29930) | 2826..3254 | - | 429 | WP_001140599.1 | hypothetical protein | - |
QP513_RS29935 (QP513_29935) | 3418..3732 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP513_RS29940 (QP513_29940) | 3720..3998 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QP513_RS29945 (QP513_29945) | 4173..4538 | - | 366 | WP_072354022.1 | TonB family protein | - |
QP513_RS29950 (QP513_29950) | 4535..4906 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
QP513_RS29955 (QP513_29955) | 5180..5425 | - | 246 | WP_032440458.1 | hypothetical protein | - |
QP513_RS29960 (QP513_29960) | 6070..7557 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11971 | 11971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T283598 WP_071177730.1 NZ_CP127157:c3732-3418 [Klebsiella pneumoniae subsp. pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|