Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 76212..76855 Replicon plasmid pT1_p2
Accession NZ_CP127155
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QP513_RS29095 Protein ID WP_001044770.1
Coordinates 76212..76628 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QP513_RS29100 Protein ID WP_001261282.1
Coordinates 76625..76855 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS29075 (72315) 72315..72587 - 273 Protein_96 transposase -
QP513_RS29085 (73569) 73569..74591 - 1023 WP_000361404.1 helicase UvrD -
QP513_RS29090 (74576) 74576..76138 - 1563 WP_004206609.1 AAA family ATPase -
QP513_RS29095 (76212) 76212..76628 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QP513_RS29100 (76625) 76625..76855 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QP513_RS29105 (76812) 76812..77273 + 462 WP_014343465.1 hypothetical protein -
QP513_RS29110 (77434) 77434..78378 + 945 WP_011977810.1 hypothetical protein -
QP513_RS29115 (78415) 78415..78807 + 393 WP_011977811.1 hypothetical protein -
QP513_RS29120 (78865) 78865..79386 + 522 WP_013214008.1 hypothetical protein -
QP513_RS29125 (79432) 79432..79635 + 204 WP_011977813.1 hypothetical protein -
QP513_RS29130 (79665) 79665..80669 + 1005 WP_011977814.1 hypothetical protein -
QP513_RS29135 (80853) 80853..81632 + 780 WP_285280997.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2 - 1..123027 123027


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T283596 WP_001044770.1 NZ_CP127155:c76628-76212 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT283596 WP_001261282.1 NZ_CP127155:c76855-76625 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References