Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 60869..61779 Replicon plasmid pT1_p1
Accession NZ_CP127154
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag QP513_RS27760 Protein ID WP_004026354.1
Coordinates 61309..61779 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag QP513_RS27755 Protein ID WP_004026357.1
Coordinates 60869..61312 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS27725 (QP513_27725) 55965..56945 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
QP513_RS27730 (QP513_27730) 57095..57280 + 186 Protein_68 EamA family transporter -
QP513_RS27735 (QP513_27735) 57423..57644 - 222 WP_004213615.1 hypothetical protein -
QP513_RS27740 (QP513_27740) 57706..59013 - 1308 Protein_70 FepA family TonB-dependent siderophore receptor -
QP513_RS27745 (QP513_27745) 59079..60059 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
QP513_RS27750 (QP513_27750) 60265..60768 + 504 Protein_72 DUF4113 domain-containing protein -
QP513_RS27755 (QP513_27755) 60869..61312 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
QP513_RS27760 (QP513_27760) 61309..61779 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
QP513_RS27765 (QP513_27765) 61928..62625 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
QP513_RS27770 (QP513_27770) 64011..64661 - 651 WP_068893702.1 DUF1173 family protein -
QP513_RS27775 (QP513_27775) 64694..64960 - 267 WP_223175074.1 DUF1173 family protein -
QP513_RS27780 (QP513_27780) 65138..65632 + 495 WP_004212794.1 thermonuclease family protein -
QP513_RS27785 (QP513_27785) 65969..66367 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN 1..221844 221844
- inside IScluster/Tn - iroN 48148..67818 19670


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T283591 WP_004026354.1 NZ_CP127154:61309-61779 [Klebsiella pneumoniae subsp. pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT283591 WP_004026357.1 NZ_CP127154:60869-61312 [Klebsiella pneumoniae subsp. pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References