Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 21126..21796 Replicon plasmid pT1_p1
Accession NZ_CP127154
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag QP513_RS27515 Protein ID WP_004213072.1
Coordinates 21353..21796 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag QP513_RS27510 Protein ID WP_004213073.1
Coordinates 21126..21356 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS27485 (QP513_27485) 16311..17090 - 780 WP_004213560.1 site-specific integrase -
QP513_RS27490 (QP513_27490) 17087..17908 - 822 WP_004213562.1 hypothetical protein -
QP513_RS27495 (QP513_27495) 18880..19086 + 207 WP_004213077.1 hypothetical protein -
QP513_RS27500 (QP513_27500) 19076..19369 - 294 WP_004213076.1 hypothetical protein -
QP513_RS27505 (QP513_27505) 19385..20518 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
QP513_RS27510 (QP513_27510) 21126..21356 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QP513_RS27515 (QP513_27515) 21353..21796 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
QP513_RS27520 (QP513_27520) 21945..22196 + 252 WP_186987481.1 hypothetical protein -
QP513_RS27525 (QP513_27525) 22219..22523 - 305 Protein_27 transposase -
QP513_RS27530 (QP513_27530) 22940..23575 + 636 Protein_28 mucoid phenotype regulator RmpA2 -
QP513_RS27535 (QP513_27535) 24093..24496 - 404 Protein_29 GAF domain-containing protein -
QP513_RS27540 (QP513_27540) 24587..25507 - 921 WP_004213934.1 DUF1471 domain-containing protein -
QP513_RS27545 (QP513_27545) 25556..26047 - 492 WP_011251327.1 DM13 domain-containing protein -
QP513_RS27550 (QP513_27550) 26110..26385 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN 1..221844 221844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T283590 WP_004213072.1 NZ_CP127154:21353-21796 [Klebsiella pneumoniae subsp. pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT283590 WP_004213073.1 NZ_CP127154:21126-21356 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References