Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4226052..4226671 | Replicon | chromosome |
| Accession | NZ_CP127153 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain T1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QP513_RS21270 | Protein ID | WP_002892050.1 |
| Coordinates | 4226453..4226671 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | QP513_RS21265 | Protein ID | WP_002892066.1 |
| Coordinates | 4226052..4226426 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP513_RS21255 (QP513_21255) | 4221204..4222397 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QP513_RS21260 (QP513_21260) | 4222420..4225566 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QP513_RS21265 (QP513_21265) | 4226052..4226426 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| QP513_RS21270 (QP513_21270) | 4226453..4226671 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QP513_RS21275 (QP513_21275) | 4226830..4227396 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| QP513_RS21280 (QP513_21280) | 4227368..4227508 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| QP513_RS21285 (QP513_21285) | 4227529..4227999 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| QP513_RS21290 (QP513_21290) | 4227974..4229425 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| QP513_RS21295 (QP513_21295) | 4229526..4230224 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| QP513_RS21300 (QP513_21300) | 4230221..4230361 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QP513_RS21305 (QP513_21305) | 4230361..4230624 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283585 WP_002892050.1 NZ_CP127153:4226453-4226671 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT283585 WP_002892066.1 NZ_CP127153:4226052-4226426 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |