Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4226052..4226671 Replicon chromosome
Accession NZ_CP127153
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QP513_RS21270 Protein ID WP_002892050.1
Coordinates 4226453..4226671 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QP513_RS21265 Protein ID WP_002892066.1
Coordinates 4226052..4226426 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS21255 (QP513_21255) 4221204..4222397 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QP513_RS21260 (QP513_21260) 4222420..4225566 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
QP513_RS21265 (QP513_21265) 4226052..4226426 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QP513_RS21270 (QP513_21270) 4226453..4226671 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QP513_RS21275 (QP513_21275) 4226830..4227396 + 567 WP_002892030.1 maltose O-acetyltransferase -
QP513_RS21280 (QP513_21280) 4227368..4227508 - 141 WP_004147370.1 hypothetical protein -
QP513_RS21285 (QP513_21285) 4227529..4227999 + 471 WP_002892026.1 YlaC family protein -
QP513_RS21290 (QP513_21290) 4227974..4229425 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QP513_RS21295 (QP513_21295) 4229526..4230224 + 699 WP_002892021.1 GNAT family protein -
QP513_RS21300 (QP513_21300) 4230221..4230361 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QP513_RS21305 (QP513_21305) 4230361..4230624 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T283585 WP_002892050.1 NZ_CP127153:4226453-4226671 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT283585 WP_002892066.1 NZ_CP127153:4226052-4226426 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References