Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1626038..1626600 | Replicon | chromosome |
Accession | NZ_CP127115 | ||
Organism | Paenarthrobacter sp. R1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QN084_RS07910 | Protein ID | WP_021472908.1 |
Coordinates | 1626310..1626600 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7M2BYL4 |
Locus tag | QN084_RS07905 | Protein ID | WP_021472907.1 |
Coordinates | 1626038..1626313 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN084_RS07885 (QN084_07885) | 1622261..1623298 | - | 1038 | WP_031216691.1 | zinc-dependent alcohol dehydrogenase family protein | - |
QN084_RS07890 (QN084_07890) | 1623428..1624240 | - | 813 | WP_021472904.1 | hypothetical protein | - |
QN084_RS07895 (QN084_07895) | 1624287..1624928 | - | 642 | WP_021472905.1 | LysE family translocator | - |
QN084_RS07900 (QN084_07900) | 1625127..1626005 | + | 879 | WP_043427191.1 | prephenate dehydratase | - |
QN084_RS07905 (QN084_07905) | 1626038..1626313 | + | 276 | WP_021472907.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QN084_RS07910 (QN084_07910) | 1626310..1626600 | + | 291 | WP_021472908.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QN084_RS07915 (QN084_07915) | 1626612..1627589 | - | 978 | WP_021472909.1 | thioredoxin-disulfide reductase | - |
QN084_RS07920 (QN084_07920) | 1627653..1629824 | - | 2172 | WP_069696782.1 | MMPL family transporter | - |
QN084_RS07925 (QN084_07925) | 1629987..1630622 | + | 636 | WP_259362707.1 | MarR family transcriptional regulator | - |
QN084_RS07930 (QN084_07930) | 1630703..1631518 | + | 816 | WP_021474094.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10888.46 Da Isoelectric Point: 10.0347
>T283569 WP_021472908.1 NZ_CP127115:1626310-1626600 [Paenarthrobacter sp. R1]
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
VSNSSLEGEPWNIQVTSPALKTFHRLPEKAASAIVEFITGALAGNPHRLSKPLTNELLGMRTARRGDYRVLFTLDIEDHV
LYVHRIQHRADVYKPR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|