Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2192268..2192784 | Replicon | chromosome |
| Accession | NZ_CP127114 | ||
| Organism | Pseudomonas sp. M2(2023) | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F8G1E7 |
| Locus tag | QN085_RS10190 | Protein ID | WP_003259987.1 |
| Coordinates | 2192503..2192784 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | F8G1E6 |
| Locus tag | QN085_RS10185 | Protein ID | WP_013972043.1 |
| Coordinates | 2192268..2192513 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN085_RS10165 (QN085_10165) | 2187695..2188237 | - | 543 | WP_013972039.1 | WYL domain-containing protein | - |
| QN085_RS10170 (QN085_10170) | 2188345..2189331 | - | 987 | WP_013972040.1 | zinc-binding dehydrogenase | - |
| QN085_RS10175 (QN085_10175) | 2189694..2190887 | + | 1194 | WP_023662327.1 | MFS transporter | - |
| QN085_RS10180 (QN085_10180) | 2190918..2192024 | + | 1107 | WP_031325095.1 | alkene reductase | - |
| QN085_RS10185 (QN085_10185) | 2192268..2192513 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QN085_RS10190 (QN085_10190) | 2192503..2192784 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QN085_RS10195 (QN085_10195) | 2192823..2193218 | - | 396 | WP_023662326.1 | hypothetical protein | - |
| QN085_RS10200 (QN085_10200) | 2193307..2194215 | - | 909 | WP_013972045.1 | LysR family transcriptional regulator | - |
| QN085_RS10205 (QN085_10205) | 2194445..2195749 | + | 1305 | WP_013972046.1 | MFS transporter | - |
| QN085_RS10210 (QN085_10210) | 2195780..2197021 | + | 1242 | WP_013972047.1 | Zn-dependent hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T283567 WP_003259987.1 NZ_CP127114:2192503-2192784 [Pseudomonas sp. M2(2023)]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|