Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 989490..990271 | Replicon | chromosome |
Accession | NZ_CP127101 | ||
Organism | Staphylococcus pseudintermedius strain 10916-77753 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | QQZ06_RS04625 | Protein ID | WP_180291797.1 |
Coordinates | 990110..990271 (+) | Length | 54 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A2A4EFJ1 |
Locus tag | QQZ06_RS04620 | Protein ID | WP_014613531.1 |
Coordinates | 989490..990089 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQZ06_RS04600 (QQZ06_04600) | 985362..986822 | + | 1461 | WP_096636872.1 | ABC transporter substrate-binding protein/permease | - |
QQZ06_RS04605 (QQZ06_04605) | 986815..987540 | + | 726 | WP_015729369.1 | amino acid ABC transporter ATP-binding protein | - |
QQZ06_RS04610 (QQZ06_04610) | 987696..988826 | + | 1131 | WP_065520439.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QQZ06_RS04615 (QQZ06_04615) | 988826..989296 | + | 471 | WP_014613530.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QQZ06_RS04620 (QQZ06_04620) | 989490..990089 | + | 600 | WP_014613531.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QQZ06_RS04625 (QQZ06_04625) | 990110..990271 | + | 162 | WP_180291797.1 | SAS053 family protein | Toxin |
QQZ06_RS04630 (QQZ06_04630) | 990392..990835 | + | 444 | WP_014613533.1 | hypothetical protein | - |
QQZ06_RS04635 (QQZ06_04635) | 991065..992450 | + | 1386 | WP_110159441.1 | class II fumarate hydratase | - |
QQZ06_RS04640 (QQZ06_04640) | 992471..993997 | + | 1527 | WP_014613535.1 | exopolyphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6228.71 Da Isoelectric Point: 4.2450
>T283566 WP_180291797.1 NZ_CP127101:990110-990271 [Staphylococcus pseudintermedius]
MKDEQKHYDNEMVDSFDDVVELGKEMEQISEANDEEKLNQAHDSKVRSDKNTK
MKDEQKHYDNEMVDSFDDVVELGKEMEQISEANDEEKLNQAHDSKVRSDKNTK
Download Length: 162 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22195.27 Da Isoelectric Point: 6.2965
>AT283566 WP_014613531.1 NZ_CP127101:989490-990089 [Staphylococcus pseudintermedius]
MAMNFKVFKDAETAATFTADILRKQLNNNPTSIVGLHLNQEEAPVLDALKKDVDRHSVDFSQIHVLDYDAQQSYYQALGV
PEKQIHHVPEDEKVESFIKHHAKTKDNKGKLTLQVVTIDTKGQIGIPMNDALLPAREIIVVVTGAVKAEQVKKLYEENGN
TTFIPSALKSHRMVTVVLDEAAAQGLPEDVRNYFTSLYA
MAMNFKVFKDAETAATFTADILRKQLNNNPTSIVGLHLNQEEAPVLDALKKDVDRHSVDFSQIHVLDYDAQQSYYQALGV
PEKQIHHVPEDEKVESFIKHHAKTKDNKGKLTLQVVTIDTKGQIGIPMNDALLPAREIIVVVTGAVKAEQVKKLYEENGN
TTFIPSALKSHRMVTVVLDEAAAQGLPEDVRNYFTSLYA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|