Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 827373..827897 | Replicon | chromosome |
Accession | NZ_CP127101 | ||
Organism | Staphylococcus pseudintermedius strain 10916-77753 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2A4EDC7 |
Locus tag | QQZ06_RS03730 | Protein ID | WP_014613379.1 |
Coordinates | 827544..827897 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A166MM16 |
Locus tag | QQZ06_RS03725 | Protein ID | WP_014613378.1 |
Coordinates | 827373..827543 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQZ06_RS03700 (QQZ06_03700) | 823262..823735 | + | 474 | WP_063279122.1 | PH domain-containing protein | - |
QQZ06_RS03705 (QQZ06_03705) | 823728..825257 | + | 1530 | WP_063279121.1 | PH domain-containing protein | - |
QQZ06_RS03710 (QQZ06_03710) | 825241..825759 | + | 519 | WP_014613375.1 | PH domain-containing protein | - |
QQZ06_RS03715 (QQZ06_03715) | 825756..826106 | + | 351 | WP_063279120.1 | holo-ACP synthase | - |
QQZ06_RS03720 (QQZ06_03720) | 826140..827288 | + | 1149 | WP_014613377.1 | alanine racemase | - |
QQZ06_RS03725 (QQZ06_03725) | 827373..827543 | + | 171 | WP_014613378.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQZ06_RS03730 (QQZ06_03730) | 827544..827897 | + | 354 | WP_014613379.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QQZ06_RS03735 (QQZ06_03735) | 827955..828959 | + | 1005 | WP_014613380.1 | PP2C family protein-serine/threonine phosphatase | - |
QQZ06_RS03740 (QQZ06_03740) | 829038..829364 | + | 327 | WP_014613381.1 | anti-sigma factor antagonist | - |
QQZ06_RS03745 (QQZ06_03745) | 829364..829843 | + | 480 | WP_031253870.1 | anti-sigma B factor RsbW | - |
QQZ06_RS03750 (QQZ06_03750) | 829818..830588 | + | 771 | WP_015729428.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13130.36 Da Isoelectric Point: 10.4439
>T283565 WP_014613379.1 NZ_CP127101:827544-827897 [Staphylococcus pseudintermedius]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A4EDC7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A166MM16 |