Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 852240..852764 | Replicon | chromosome |
Accession | NZ_CP127100 | ||
Organism | Staphylococcus pseudintermedius strain 6127-64107 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2A4EDC7 |
Locus tag | QQZ05_RS03780 | Protein ID | WP_014613379.1 |
Coordinates | 852411..852764 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A166MM16 |
Locus tag | QQZ05_RS03775 | Protein ID | WP_014613378.1 |
Coordinates | 852240..852410 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQZ05_RS03750 (QQZ05_03750) | 848129..848602 | + | 474 | WP_014613373.1 | PH domain-containing protein | - |
QQZ05_RS03755 (QQZ05_03755) | 848595..850124 | + | 1530 | WP_099997491.1 | PH domain-containing protein | - |
QQZ05_RS03760 (QQZ05_03760) | 850108..850626 | + | 519 | WP_014613375.1 | PH domain-containing protein | - |
QQZ05_RS03765 (QQZ05_03765) | 850623..850973 | + | 351 | WP_014613376.1 | holo-ACP synthase | - |
QQZ05_RS03770 (QQZ05_03770) | 851007..852155 | + | 1149 | WP_014613377.1 | alanine racemase | - |
QQZ05_RS03775 (QQZ05_03775) | 852240..852410 | + | 171 | WP_014613378.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQZ05_RS03780 (QQZ05_03780) | 852411..852764 | + | 354 | WP_014613379.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QQZ05_RS03785 (QQZ05_03785) | 852822..853826 | + | 1005 | WP_014613380.1 | PP2C family protein-serine/threonine phosphatase | - |
QQZ05_RS03790 (QQZ05_03790) | 853905..854231 | + | 327 | WP_014613381.1 | anti-sigma factor antagonist | - |
QQZ05_RS03795 (QQZ05_03795) | 854231..854710 | + | 480 | WP_031253870.1 | anti-sigma B factor RsbW | - |
QQZ05_RS03800 (QQZ05_03800) | 854685..855455 | + | 771 | WP_015729428.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13130.36 Da Isoelectric Point: 10.4439
>T283562 WP_014613379.1 NZ_CP127100:852411-852764 [Staphylococcus pseudintermedius]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A4EDC7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A166MM16 |