283558

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1972243..1972711 Replicon chromosome
Accession NZ_CP127096
Organism Staphylococcus haemolyticus strain M1691_10

Toxin (Protein)


Gene name TsaT Uniprot ID Q4L4Q4
Locus tag QQO14_RS09740 Protein ID WP_011276326.1
Coordinates 1972523..1972711 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A855TTI4
Locus tag QQO14_RS09735 Protein ID WP_037537251.1
Coordinates 1972243..1972500 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO14_RS09700 1967397..1968122 - 726 WP_037537247.1 type I 3-dehydroquinate dehydratase -
QQO14_RS09705 1968285..1968707 + 423 WP_285490231.1 organic hydroperoxide resistance protein -
QQO14_RS09710 1968993..1969484 + 492 WP_053017930.1 GNAT family N-acetyltransferase -
QQO14_RS09715 1969614..1970231 + 618 WP_285490232.1 LysE family transporter -
QQO14_RS09720 1970419..1971027 - 609 WP_285490234.1 histidine phosphatase family protein -
QQO14_RS09725 1971255..1971497 + 243 WP_285490236.1 hypothetical protein -
QQO14_RS09730 1971489..1971692 - 204 WP_033079647.1 sterile alpha motif-like domain-containing protein -
QQO14_RS09735 1972243..1972500 + 258 WP_037537251.1 hypothetical protein Antitoxin
QQO14_RS09740 1972523..1972711 + 189 WP_011276326.1 hypothetical protein Toxin
QQO14_RS09745 1972829..1973410 + 582 WP_285490237.1 lipoprotein N-acylation protein LnsA -
QQO14_RS09750 1973458..1973694 - 237 WP_285490239.1 hypothetical protein -
QQO14_RS09755 1973864..1974610 + 747 WP_285491743.1 hypothetical protein -
QQO14_RS09760 1974679..1975287 - 609 WP_285490241.1 GNAT family N-acetyltransferase -
QQO14_RS09765 1975424..1976170 + 747 WP_285490242.1 poly-gamma-glutamate hydrolase family protein -
QQO14_RS09770 1976246..1976533 + 288 WP_285490244.1 hypothetical protein -
QQO14_RS09775 1976594..1976818 + 225 WP_285490246.1 hypothetical protein -
QQO14_RS09780 1976946..1977677 + 732 WP_285490247.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7110.80 Da        Isoelectric Point: 9.6269

>T283558 WP_011276326.1 NZ_CP127096:1972523-1972711 [Staphylococcus haemolyticus]
MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9838.90 Da        Isoelectric Point: 4.3699

>AT283558 WP_037537251.1 NZ_CP127096:1972243-1972500 [Staphylococcus haemolyticus]
MNNNKIFWINIFITLLFLGFNIIVTYNAGLDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIVMLLYYIYPM
VYTFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A1KAB5

Antitoxin

Source ID Structure
AlphaFold DB A0A855TTI4

References