Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1053626..1054397 | Replicon | chromosome |
| Accession | NZ_CP127096 | ||
| Organism | Staphylococcus haemolyticus strain M1691_10 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | QQO14_RS05360 | Protein ID | WP_107637350.1 |
| Coordinates | 1054248..1054397 (+) | Length | 50 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | Q4L7F8 |
| Locus tag | QQO14_RS05355 | Protein ID | WP_011275409.1 |
| Coordinates | 1053626..1054225 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO14_RS05335 | 1049512..1050963 | + | 1452 | Protein_1015 | ABC transporter substrate-binding protein/permease | - |
| QQO14_RS05340 | 1050956..1051678 | + | 723 | WP_016931345.1 | amino acid ABC transporter ATP-binding protein | - |
| QQO14_RS05345 | 1051856..1052983 | + | 1128 | WP_240575976.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QQO14_RS05350 | 1052984..1053454 | + | 471 | WP_037538647.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QQO14_RS05355 | 1053626..1054225 | + | 600 | WP_011275409.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QQO14_RS05360 | 1054248..1054397 | + | 150 | WP_107637350.1 | SAS053 family protein | Toxin |
| QQO14_RS05365 | 1054608..1055003 | + | 396 | WP_053041937.1 | hypothetical protein | - |
| QQO14_RS05370 | 1055211..1056596 | + | 1386 | WP_011275412.1 | class II fumarate hydratase | - |
| QQO14_RS05375 | 1056659..1057483 | - | 825 | WP_053016825.1 | RluA family pseudouridine synthase | - |
| QQO14_RS05380 | 1057671..1058780 | + | 1110 | WP_285491533.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5782.16 Da Isoelectric Point: 3.9365
>T283557 WP_107637350.1 NZ_CP127096:1054248-1054397 [Staphylococcus haemolyticus]
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHD
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHD
Download Length: 150 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22272.12 Da Isoelectric Point: 4.7588
>AT283557 WP_011275409.1 NZ_CP127096:1053626-1054225 [Staphylococcus haemolyticus]
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|