Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 922079..922611 | Replicon | chromosome |
Accession | NZ_CP127096 | ||
Organism | Staphylococcus haemolyticus strain M1691_10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q4L7V3 |
Locus tag | QQO14_RS04570 | Protein ID | WP_011275272.1 |
Coordinates | 922246..922611 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2K0A6Q6 |
Locus tag | QQO14_RS04565 | Protein ID | WP_037538759.1 |
Coordinates | 922079..922249 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQO14_RS04540 | 917865..918344 | + | 480 | WP_285491378.1 | PH domain-containing protein | - |
QQO14_RS04545 | 918337..919860 | + | 1524 | WP_285491380.1 | PH domain-containing protein | - |
QQO14_RS04550 | 919853..920380 | + | 528 | WP_285491383.1 | PH domain-containing protein | - |
QQO14_RS04555 | 920390..920749 | + | 360 | WP_011275269.1 | holo-ACP synthase | - |
QQO14_RS04560 | 920845..921993 | + | 1149 | WP_285491385.1 | alanine racemase | - |
QQO14_RS04565 | 922079..922249 | + | 171 | WP_037538759.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQO14_RS04570 | 922246..922611 | + | 366 | WP_011275272.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QQO14_RS04575 | 922919..923920 | + | 1002 | WP_285491386.1 | PP2C family protein-serine/threonine phosphatase | - |
QQO14_RS04580 | 924019..924345 | + | 327 | WP_285491388.1 | anti-sigma factor antagonist | - |
QQO14_RS04585 | 924374..924826 | + | 453 | WP_285491725.1 | anti-sigma B factor RsbW | - |
QQO14_RS04590 | 924801..925571 | + | 771 | WP_285491390.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13672.75 Da Isoelectric Point: 8.4121
>T283556 WP_011275272.1 NZ_CP127096:922246-922611 [Staphylococcus haemolyticus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A1KA75 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K0A6Q6 |