Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3525116..3526032 | Replicon | chromosome |
Accession | NZ_CP127095 | ||
Organism | Bacillus inaquosorum strain LBA001 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QMC72_RS17585 | Protein ID | WP_133487760.1 |
Coordinates | 3525116..3525862 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4NV07 |
Locus tag | QMC72_RS17590 | Protein ID | WP_003239095.1 |
Coordinates | 3525862..3526032 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMC72_RS17560 (QMC72_17560) | 3520200..3520346 | - | 147 | WP_019258173.1 | hypothetical protein | - |
QMC72_RS17565 (QMC72_17565) | 3520447..3521397 | - | 951 | WP_019258172.1 | ring-cleaving dioxygenase | - |
QMC72_RS17570 (QMC72_17570) | 3521783..3523099 | + | 1317 | WP_088111058.1 | serine/threonine exchanger | - |
QMC72_RS17575 (QMC72_17575) | 3523375..3523992 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QMC72_RS17580 (QMC72_17580) | 3524005..3525006 | + | 1002 | WP_003239093.1 | inorganic phosphate transporter | - |
QMC72_RS17585 (QMC72_17585) | 3525116..3525862 | + | 747 | WP_133487760.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QMC72_RS17590 (QMC72_17590) | 3525862..3526032 | + | 171 | WP_003239095.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QMC72_RS17595 (QMC72_17595) | 3526117..3526254 | + | 138 | WP_119913750.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QMC72_RS17600 (QMC72_17600) | 3526291..3527184 | - | 894 | WP_003239098.1 | N-acetylmuramoyl-L-alanine amidase | - |
QMC72_RS17605 (QMC72_17605) | 3527197..3527460 | - | 264 | WP_003239099.1 | phage holin | - |
QMC72_RS17610 (QMC72_17610) | 3527473..3527742 | - | 270 | WP_060398448.1 | hemolysin XhlA family protein | - |
QMC72_RS17615 (QMC72_17615) | 3527795..3528634 | - | 840 | WP_133487762.1 | phage portal protein | - |
QMC72_RS17620 (QMC72_17620) | 3528681..3528845 | - | 165 | WP_133487764.1 | XkdX family protein | - |
QMC72_RS17625 (QMC72_17625) | 3528842..3529168 | - | 327 | WP_133487766.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29070.54 Da Isoelectric Point: 4.6135
>T283554 WP_133487760.1 NZ_CP127095:3525116-3525862 [Bacillus inaquosorum]
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYDPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCVMAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYDPSSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKMVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|