Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2479700..2480336 | Replicon | chromosome |
Accession | NZ_CP127095 | ||
Organism | Bacillus inaquosorum strain LBA001 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QMC72_RS12890 | Protein ID | WP_003156187.1 |
Coordinates | 2479700..2480050 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QMC72_RS12895 | Protein ID | WP_003225183.1 |
Coordinates | 2480055..2480336 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMC72_RS12850 (QMC72_12850) | 2474744..2475343 | - | 600 | WP_133488401.1 | phosphoserine phosphatase RsbX | - |
QMC72_RS12855 (QMC72_12855) | 2475343..2476131 | - | 789 | WP_003240361.1 | RNA polymerase sigma factor SigB | - |
QMC72_RS12860 (QMC72_12860) | 2476097..2476579 | - | 483 | WP_003240359.1 | anti-sigma B factor RsbW | - |
QMC72_RS12865 (QMC72_12865) | 2476576..2476905 | - | 330 | WP_003240357.1 | anti-sigma factor antagonist RsbV | - |
QMC72_RS12870 (QMC72_12870) | 2476967..2477974 | - | 1008 | WP_003240354.1 | phosphoserine phosphatase RsbU | - |
QMC72_RS12875 (QMC72_12875) | 2477986..2478387 | - | 402 | WP_003240352.1 | serine/threonine-protein kinase RsbT | - |
QMC72_RS12880 (QMC72_12880) | 2478391..2478756 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QMC72_RS12885 (QMC72_12885) | 2478761..2479585 | - | 825 | WP_133488403.1 | RsbT co-antagonist protein RsbRA | - |
QMC72_RS12890 (QMC72_12890) | 2479700..2480050 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QMC72_RS12895 (QMC72_12895) | 2480055..2480336 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QMC72_RS12900 (QMC72_12900) | 2480451..2481620 | - | 1170 | WP_133488405.1 | alanine racemase | - |
QMC72_RS12905 (QMC72_12905) | 2481735..2482751 | - | 1017 | WP_133488407.1 | outer membrane lipoprotein carrier protein LolA | - |
QMC72_RS12910 (QMC72_12910) | 2482916..2483281 | - | 366 | WP_003240339.1 | holo-ACP synthase | - |
QMC72_RS12915 (QMC72_12915) | 2483376..2483975 | + | 600 | WP_003240338.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T283553 WP_003156187.1 NZ_CP127095:c2480050-2479700 [Bacillus inaquosorum]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|