Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 942225..942749 | Replicon | chromosome |
Accession | NZ_CP127094 | ||
Organism | Staphylococcus pseudintermedius strain 19KM0990 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2A4EDC7 |
Locus tag | QQO15_RS04335 | Protein ID | WP_014613379.1 |
Coordinates | 942396..942749 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A166MM16 |
Locus tag | QQO15_RS04330 | Protein ID | WP_014613378.1 |
Coordinates | 942225..942395 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQO15_RS04305 (QQO15_04305) | 938114..938587 | + | 474 | WP_014613373.1 | PH domain-containing protein | - |
QQO15_RS04310 (QQO15_04310) | 938580..940109 | + | 1530 | WP_105503167.1 | PH domain-containing protein | - |
QQO15_RS04315 (QQO15_04315) | 940093..940611 | + | 519 | WP_014613375.1 | PH domain-containing protein | - |
QQO15_RS04320 (QQO15_04320) | 940608..940958 | + | 351 | WP_014613376.1 | holo-ACP synthase | - |
QQO15_RS04325 (QQO15_04325) | 940992..942140 | + | 1149 | WP_014613377.1 | alanine racemase | - |
QQO15_RS04330 (QQO15_04330) | 942225..942395 | + | 171 | WP_014613378.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQO15_RS04335 (QQO15_04335) | 942396..942749 | + | 354 | WP_014613379.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QQO15_RS04340 (QQO15_04340) | 942807..943811 | + | 1005 | WP_014613380.1 | PP2C family protein-serine/threonine phosphatase | - |
QQO15_RS04345 (QQO15_04345) | 943890..944216 | + | 327 | WP_014613381.1 | anti-sigma factor antagonist | - |
QQO15_RS04350 (QQO15_04350) | 944216..944695 | + | 480 | WP_031253870.1 | anti-sigma B factor RsbW | - |
QQO15_RS04355 (QQO15_04355) | 944670..945440 | + | 771 | WP_015729428.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13130.36 Da Isoelectric Point: 10.4439
>T283552 WP_014613379.1 NZ_CP127094:942396-942749 [Staphylococcus pseudintermedius]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEKKMKEVNNAIGISLGLHMNHHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A4EDC7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A166MM16 |