Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 22922..23533 | Replicon | plasmid pPlaYM7902D |
Accession | NZ_CP127049 | ||
Organism | Pseudomonas amygdali pv. lachrymans strain YM7902 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A3M3DN15 |
Locus tag | QO021_RS31485 | Protein ID | WP_005746121.1 |
Coordinates | 23183..23533 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A3M5ISD9 |
Locus tag | QO021_RS31480 | Protein ID | WP_005746122.1 |
Coordinates | 22922..23170 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO021_RS31450 (QO021_31445) | 18873..19106 | - | 234 | WP_005746115.1 | hypothetical protein | - |
QO021_RS31455 (QO021_31450) | 19145..19570 | + | 426 | Protein_26 | IS5/IS1182 family transposase | - |
QO021_RS31460 (QO021_31455) | 19926..20546 | - | 621 | WP_004642393.1 | hypothetical protein | - |
QO021_RS31465 (QO021_31460) | 20543..20809 | - | 267 | WP_004642394.1 | hypothetical protein | - |
QO021_RS31470 (QO021_31465) | 21263..21529 | + | 267 | WP_227024934.1 | hypothetical protein | - |
QO021_RS31475 (QO021_31470) | 21597..22574 | + | 978 | WP_007247761.1 | IS5 family transposase | - |
QO021_RS31480 (QO021_31475) | 22922..23170 | + | 249 | WP_005746122.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QO021_RS31485 (QO021_31480) | 23183..23533 | + | 351 | WP_005746121.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QO021_RS31490 (QO021_31485) | 23702..24160 | - | 459 | WP_272939231.1 | type III effector | - |
QO021_RS31495 (QO021_31490) | 24396..25373 | + | 978 | WP_007247761.1 | IS5 family transposase | - |
QO021_RS31500 (QO021_31495) | 25987..26964 | + | 978 | WP_285230714.1 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..47967 | 47967 | |
- | inside | IScluster/Tn | - | - | 7350..47698 | 40348 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12844.78 Da Isoelectric Point: 4.5514
>T283549 WP_005746121.1 NZ_CP127049:23183-23533 [Pseudomonas amygdali pv. lachrymans]
MTTFALRFTEVAQQSLEDQVEHLAVTQGFSSAARRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSGGITGIVVLLVLGGKQSVEQALIRYCLLQLI
MTTFALRFTEVAQQSLEDQVEHLAVTQGFSSAARRIDSLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSGGITGIVVLLVLGGKQSVEQALIRYCLLQLI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M3DN15 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3M5ISD9 |