Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 13230..13699 Replicon plasmid pPlaYM7902C
Accession NZ_CP127048
Organism Pseudomonas amygdali pv. lachrymans strain YM7902

Toxin (Protein)


Gene name relE Uniprot ID Q48BA0
Locus tag QO021_RS31085 Protein ID WP_002556029.1
Coordinates 13230..13511 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q48BA1
Locus tag QO021_RS31090 Protein ID WP_002556028.1
Coordinates 13511..13699 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QO021_RS31070 (QO021_31065) 8918..9895 + 978 WP_007247761.1 IS5 family transposase -
QO021_RS31075 (QO021_31070) 10395..11372 + 978 WP_007247761.1 IS5 family transposase -
QO021_RS31080 (QO021_31075) 11669..12811 + 1143 WP_005746165.1 IQ calmodulin-binding motif-containing protein -
QO021_RS31085 (QO021_31080) 13230..13511 - 282 WP_002556029.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QO021_RS31090 (QO021_31085) 13511..13699 - 189 WP_002556028.1 hypothetical protein Antitoxin
QO021_RS31095 (QO021_31090) 13888..14523 - 636 WP_054068142.1 recombinase family protein -
QO021_RS31100 (QO021_31095) 14712..15470 + 759 WP_227024931.1 ParA family protein -
QO021_RS31105 (QO021_31100) 15506..15760 + 255 WP_003381801.1 hypothetical protein -
QO021_RS31110 (QO021_31105) 16185..16850 - 666 WP_004667059.1 LexA family transcriptional regulator -
QO021_RS31115 (QO021_31110) 16938..17168 + 231 WP_032704469.1 Cro/CI family transcriptional regulator -
QO021_RS31120 (QO021_31115) 17518..18207 + 690 WP_005746161.1 lytic transglycosylase domain-containing protein -
QO021_RS31125 (QO021_31120) 18204..18542 + 339 WP_017279422.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..53818 53818


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10675.35 Da        Isoelectric Point: 8.4392

>T283548 WP_002556029.1 NZ_CP127048:c13511-13230 [Pseudomonas amygdali pv. lachrymans]
MLPVVWLSPALDDLREIATYIAWENPSAARRLKSLLQEAIEPVAEHPYLYRSGRAPGTRELVAHPNYVLVYRVTLKRIEV
VNVIHARQEYPSP

Download         Length: 282 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 7043.86 Da        Isoelectric Point: 4.2550

>AT283548 WP_002556028.1 NZ_CP127048:c13699-13511 [Pseudomonas amygdali pv. lachrymans]
MANLSPIVSEFETDEQAASYDRWFRAKVAASLADPRPAIPHDEVMAEIEALIDQVETQREKR

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M9HVA1

Antitoxin

Source ID Structure
AlphaFold DB A0A2G9KWB9

References