Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 13230..13699 | Replicon | plasmid pPlaYM7902C |
| Accession | NZ_CP127048 | ||
| Organism | Pseudomonas amygdali pv. lachrymans strain YM7902 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q48BA0 |
| Locus tag | QO021_RS31085 | Protein ID | WP_002556029.1 |
| Coordinates | 13230..13511 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q48BA1 |
| Locus tag | QO021_RS31090 | Protein ID | WP_002556028.1 |
| Coordinates | 13511..13699 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO021_RS31070 (QO021_31065) | 8918..9895 | + | 978 | WP_007247761.1 | IS5 family transposase | - |
| QO021_RS31075 (QO021_31070) | 10395..11372 | + | 978 | WP_007247761.1 | IS5 family transposase | - |
| QO021_RS31080 (QO021_31075) | 11669..12811 | + | 1143 | WP_005746165.1 | IQ calmodulin-binding motif-containing protein | - |
| QO021_RS31085 (QO021_31080) | 13230..13511 | - | 282 | WP_002556029.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QO021_RS31090 (QO021_31085) | 13511..13699 | - | 189 | WP_002556028.1 | hypothetical protein | Antitoxin |
| QO021_RS31095 (QO021_31090) | 13888..14523 | - | 636 | WP_054068142.1 | recombinase family protein | - |
| QO021_RS31100 (QO021_31095) | 14712..15470 | + | 759 | WP_227024931.1 | ParA family protein | - |
| QO021_RS31105 (QO021_31100) | 15506..15760 | + | 255 | WP_003381801.1 | hypothetical protein | - |
| QO021_RS31110 (QO021_31105) | 16185..16850 | - | 666 | WP_004667059.1 | LexA family transcriptional regulator | - |
| QO021_RS31115 (QO021_31110) | 16938..17168 | + | 231 | WP_032704469.1 | Cro/CI family transcriptional regulator | - |
| QO021_RS31120 (QO021_31115) | 17518..18207 | + | 690 | WP_005746161.1 | lytic transglycosylase domain-containing protein | - |
| QO021_RS31125 (QO021_31120) | 18204..18542 | + | 339 | WP_017279422.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..53818 | 53818 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10675.35 Da Isoelectric Point: 8.4392
>T283548 WP_002556029.1 NZ_CP127048:c13511-13230 [Pseudomonas amygdali pv. lachrymans]
MLPVVWLSPALDDLREIATYIAWENPSAARRLKSLLQEAIEPVAEHPYLYRSGRAPGTRELVAHPNYVLVYRVTLKRIEV
VNVIHARQEYPSP
MLPVVWLSPALDDLREIATYIAWENPSAARRLKSLLQEAIEPVAEHPYLYRSGRAPGTRELVAHPNYVLVYRVTLKRIEV
VNVIHARQEYPSP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M9HVA1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G9KWB9 |