Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RHH |
Location | 4054242..4054755 | Replicon | chromosome |
Accession | NZ_CP127045 | ||
Organism | Pseudomonas amygdali pv. lachrymans strain YM7902 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QO021_RS18865 | Protein ID | WP_004658391.1 |
Coordinates | 4054471..4054755 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0N8T2X1 |
Locus tag | QO021_RS18860 | Protein ID | WP_029241049.1 |
Coordinates | 4054242..4054481 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QO021_RS18840 (QO021_18835) | 4050351..4051136 | + | 786 | WP_002552796.1 | outer membrane protein OmpK | - |
QO021_RS18845 (QO021_18840) | 4051315..4052223 | - | 909 | WP_005744311.1 | DUF808 domain-containing protein | - |
QO021_RS18850 (QO021_18845) | 4052373..4052879 | - | 507 | WP_004658394.1 | Lrp/AsnC family transcriptional regulator | - |
QO021_RS18855 (QO021_18850) | 4053066..4054082 | + | 1017 | WP_002552793.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
QO021_RS18860 (QO021_18855) | 4054242..4054481 | + | 240 | WP_029241049.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QO021_RS18865 (QO021_18860) | 4054471..4054755 | + | 285 | WP_004658391.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QO021_RS18870 (QO021_18865) | 4054792..4055646 | - | 855 | WP_004658390.1 | LysR family transcriptional regulator | - |
QO021_RS18875 (QO021_18870) | 4055721..4056653 | + | 933 | WP_039847441.1 | DMT family transporter | - |
QO021_RS18880 (QO021_18875) | 4056684..4058612 | - | 1929 | WP_010198401.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10647.31 Da Isoelectric Point: 10.4249
>T283547 WP_004658391.1 NZ_CP127045:4054471-4054755 [Pseudomonas amygdali pv. lachrymans]
MQVEWLKTALKNLDEEAAYIAQDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHTRRQSPPVW
MQVEWLKTALKNLDEEAAYIAQDNPAAAAAFVKAIQSSVTQLASFPAMGREGRIAGTREWPLPDLPYLIPYRIRSGRLQV
LRIFHTRRQSPPVW
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|