Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 624021..624616 | Replicon | chromosome |
| Accession | NZ_CP127045 | ||
| Organism | Pseudomonas amygdali pv. lachrymans strain YM7902 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3M3ZKH5 |
| Locus tag | QO021_RS02965 | Protein ID | WP_005746690.1 |
| Coordinates | 624314..624616 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0P9S822 |
| Locus tag | QO021_RS02960 | Protein ID | WP_005746689.1 |
| Coordinates | 624021..624311 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QO021_RS02945 (QO021_02945) | 621583..622956 | - | 1374 | WP_005746685.1 | PepSY domain-containing protein | - |
| QO021_RS02950 (QO021_02950) | 623041..623475 | - | 435 | WP_005746686.1 | DUF2946 domain-containing protein | - |
| QO021_RS02955 (QO021_02955) | 623489..623950 | - | 462 | WP_005746687.1 | copper chaperone PCu(A)C | - |
| QO021_RS02960 (QO021_02960) | 624021..624311 | - | 291 | WP_005746689.1 | putative addiction module antidote protein | Antitoxin |
| QO021_RS02965 (QO021_02965) | 624314..624616 | - | 303 | WP_005746690.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QO021_RS02970 (QO021_02970) | 624766..625506 | - | 741 | WP_005746691.1 | cobalt-precorrin-6A reductase | - |
| QO021_RS02975 (QO021_02975) | 625503..626615 | - | 1113 | WP_005746694.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
| QO021_RS02980 (QO021_02980) | 626615..627817 | - | 1203 | WP_005746695.1 | bifunctional cobalt-precorrin-7 (C(5))-methyltransferase/cobalt-precorrin-6B (C(15))-methyltransferase | - |
| QO021_RS02985 (QO021_02985) | 627943..629283 | + | 1341 | WP_080164792.1 | precorrin-3B synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11477.21 Da Isoelectric Point: 10.6008
>T283546 WP_005746690.1 NZ_CP127045:c624616-624314 [Pseudomonas amygdali pv. lachrymans]
MNRFEQTPAFAEWLRSLKDSIGRARILARIRAAELGNFGDCDALGQGVRELRIHHGPGYRVYFARRTGVVYLLLIAGDKS
SQKRDIKFARQLARELCERE
MNRFEQTPAFAEWLRSLKDSIGRARILARIRAAELGNFGDCDALGQGVRELRIHHGPGYRVYFARRTGVVYLLLIAGDKS
SQKRDIKFARQLARELCERE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3M3ZKH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9S822 |