Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA(toxin)
Location 304342..304981 Replicon chromosome
Accession NZ_CP127045
Organism Pseudomonas amygdali pv. lachrymans strain YM7902

Toxin (Protein)


Gene name hicA Uniprot ID A0A7Z6Y3C5
Locus tag QO021_RS01380 Protein ID WP_005781617.1
Coordinates 304342..304524 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A0Q0DRU8
Locus tag QO021_RS01385 Protein ID WP_016981256.1
Coordinates 304556..304981 (+) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QO021_RS01345 (QO021_01345) 299703..300296 + 594 WP_002551454.1 imidazoleglycerol-phosphate dehydratase HisB -
QO021_RS01350 (QO021_01350) 300296..300934 + 639 WP_005745046.1 imidazole glycerol phosphate synthase subunit HisH -
QO021_RS01355 (QO021_01355) 300939..301199 + 261 WP_002551456.1 DUF2164 domain-containing protein -
QO021_RS01360 (QO021_01360) 301307..302044 + 738 WP_002551457.1 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
QO021_RS01365 (QO021_01365) 302064..302834 + 771 WP_002551458.1 imidazole glycerol phosphate synthase subunit HisF -
QO021_RS01370 (QO021_01370) 303020..303775 + 756 WP_004663214.1 ABC transporter substrate-binding protein -
QO021_RS01375 (QO021_01375) 303780..304020 - 241 Protein_271 serine protease -
QO021_RS01380 (QO021_01380) 304342..304524 + 183 WP_005781617.1 type II toxin-antitoxin system HicA family toxin Toxin
QO021_RS01385 (QO021_01385) 304556..304981 + 426 WP_016981256.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QO021_RS01390 (QO021_01390) 305036..305818 - 783 WP_005745049.1 divergent polysaccharide deacetylase family protein -
QO021_RS01395 (QO021_01395) 305822..307165 - 1344 WP_005745050.1 S41 family peptidase -
QO021_RS01400 (QO021_01400) 307199..308521 - 1323 WP_029240926.1 murein hydrolase activator EnvC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-58)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6877.97 Da        Isoelectric Point: 10.6211

>T283545 WP_005781617.1 NZ_CP127045:304342-304524 [Pseudomonas amygdali pv. lachrymans]
MKCNEFRRWLQAQGAEFRAAKGSHFKVYLNGKATIFADHGSKEMHEGLRKSIIKQLGLKD

Download         Length: 183 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15783.24 Da        Isoelectric Point: 5.2548

>AT283545 WP_016981256.1 NZ_CP127045:304556-304981 [Pseudomonas amygdali pv. lachrymans]
MYQYPLDLHREPTGVWLSCPDIPEMSASGDTLPEAFSEALDGMESALSLYVDQRRKIPQASVVPGHELLMRLPALTVAKI
MLWNSLLEEGVSRAELARRLGCTRQVVDRLVDFLHASKIEQVERALAELGRRITLSIERAA

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z6Y3C5

Antitoxin

Source ID Structure
AlphaFold DB A0A0Q0DRU8

References