Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 1664530..1665318 | Replicon | chromosome |
| Accession | NZ_CP127024 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | QQO08_RS08205 | Protein ID | WP_000525004.1 |
| Coordinates | 1664857..1665318 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | QQO08_RS08200 | Protein ID | WP_000333630.1 |
| Coordinates | 1664530..1664844 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO08_RS08140 (QQO08_08140) | 1659673..1660839 | - | 1167 | WP_000762532.1 | DUF2800 domain-containing protein | - |
| QQO08_RS08145 (QQO08_08145) | 1660836..1661198 | - | 363 | WP_000985983.1 | hypothetical protein | - |
| QQO08_RS08150 (QQO08_08150) | 1661213..1661536 | - | 324 | WP_000175000.1 | hypothetical protein | - |
| QQO08_RS08155 (QQO08_08155) | 1661615..1661776 | - | 162 | WP_001285962.1 | DUF1270 domain-containing protein | - |
| QQO08_RS08160 (QQO08_08160) | 1661788..1662051 | - | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| QQO08_RS08165 (QQO08_08165) | 1662076..1662291 | - | 216 | WP_001097555.1 | hypothetical protein | - |
| QQO08_RS08170 (QQO08_08170) | 1662346..1662711 | + | 366 | WP_001128433.1 | hypothetical protein | - |
| QQO08_RS08175 (QQO08_08175) | 1662680..1662925 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| QQO08_RS08180 (QQO08_08180) | 1662981..1663190 | + | 210 | WP_000642492.1 | hypothetical protein | - |
| QQO08_RS08185 (QQO08_08185) | 1663180..1663323 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| QQO08_RS08190 (QQO08_08190) | 1663352..1664128 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| QQO08_RS08195 (QQO08_08195) | 1664142..1664378 | - | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| QQO08_RS08200 (QQO08_08200) | 1664530..1664844 | + | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QQO08_RS08205 (QQO08_08205) | 1664857..1665318 | + | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| QQO08_RS08210 (QQO08_08210) | 1665388..1665921 | + | 534 | WP_251420282.1 | gas vesicle protein GvpG | - |
| QQO08_RS08215 (QQO08_08215) | 1666151..1666297 | + | 147 | WP_001013104.1 | hypothetical protein | - |
| QQO08_RS08220 (QQO08_08220) | 1666294..1666908 | - | 615 | WP_000191459.1 | hypothetical protein | - |
| QQO08_RS08225 (QQO08_08225) | 1667034..1668239 | + | 1206 | WP_020444721.1 | site-specific integrase | - |
| QQO08_RS08230 (QQO08_08230) | 1668282..1670309 | - | 2028 | WP_001566047.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1622280..1680995 | 58715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T283534 WP_000525004.1 NZ_CP127024:1664857-1665318 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |