Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1664530..1665318 Replicon chromosome
Accession NZ_CP127024
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag QQO08_RS08205 Protein ID WP_000525004.1
Coordinates 1664857..1665318 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag QQO08_RS08200 Protein ID WP_000333630.1
Coordinates 1664530..1664844 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO08_RS08140 (QQO08_08140) 1659673..1660839 - 1167 WP_000762532.1 DUF2800 domain-containing protein -
QQO08_RS08145 (QQO08_08145) 1660836..1661198 - 363 WP_000985983.1 hypothetical protein -
QQO08_RS08150 (QQO08_08150) 1661213..1661536 - 324 WP_000175000.1 hypothetical protein -
QQO08_RS08155 (QQO08_08155) 1661615..1661776 - 162 WP_001285962.1 DUF1270 domain-containing protein -
QQO08_RS08160 (QQO08_08160) 1661788..1662051 - 264 WP_001124198.1 helix-turn-helix domain-containing protein -
QQO08_RS08165 (QQO08_08165) 1662076..1662291 - 216 WP_001097555.1 hypothetical protein -
QQO08_RS08170 (QQO08_08170) 1662346..1662711 + 366 WP_001128433.1 hypothetical protein -
QQO08_RS08175 (QQO08_08175) 1662680..1662925 - 246 WP_001025401.1 DUF2829 domain-containing protein -
QQO08_RS08180 (QQO08_08180) 1662981..1663190 + 210 WP_000642492.1 hypothetical protein -
QQO08_RS08185 (QQO08_08185) 1663180..1663323 - 144 WP_000939498.1 hypothetical protein -
QQO08_RS08190 (QQO08_08190) 1663352..1664128 - 777 WP_001148544.1 Rha family transcriptional regulator -
QQO08_RS08195 (QQO08_08195) 1664142..1664378 - 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
QQO08_RS08200 (QQO08_08200) 1664530..1664844 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
QQO08_RS08205 (QQO08_08205) 1664857..1665318 + 462 WP_000525004.1 hypothetical protein Toxin
QQO08_RS08210 (QQO08_08210) 1665388..1665921 + 534 WP_251420282.1 gas vesicle protein GvpG -
QQO08_RS08215 (QQO08_08215) 1666151..1666297 + 147 WP_001013104.1 hypothetical protein -
QQO08_RS08220 (QQO08_08220) 1666294..1666908 - 615 WP_000191459.1 hypothetical protein -
QQO08_RS08225 (QQO08_08225) 1667034..1668239 + 1206 WP_020444721.1 site-specific integrase -
QQO08_RS08230 (QQO08_08230) 1668282..1670309 - 2028 WP_001566047.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1622280..1680995 58715


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T283534 WP_000525004.1 NZ_CP127024:1664857-1665318 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT283534 WP_000333630.1 NZ_CP127024:1664530-1664844 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References