Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 957189..957694 | Replicon | chromosome |
Accession | NZ_CP127024 | ||
Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A |
Toxin (Protein)
Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
Locus tag | QQO08_RS04770 | Protein ID | WP_001103946.1 |
Coordinates | 957401..957694 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | X5IA75 |
Locus tag | QQO08_RS04765 | Protein ID | WP_001058492.1 |
Coordinates | 957189..957398 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQO08_RS04730 (QQO08_04730) | 952706..953926 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
QQO08_RS04735 (QQO08_04735) | 954014..954742 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
QQO08_RS04740 (QQO08_04740) | 954766..955494 | - | 729 | WP_001033317.1 | staphylococcal enterotoxin type Q | - |
QQO08_RS04745 (QQO08_04745) | 955669..956403 | - | 735 | WP_000142630.1 | helix-turn-helix transcriptional regulator | - |
QQO08_RS04750 (QQO08_04750) | 956553..956765 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
QQO08_RS04755 (QQO08_04755) | 956766..957038 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
QQO08_RS04760 (QQO08_04760) | 957050..957196 | + | 147 | WP_000784885.1 | hypothetical protein | - |
QQO08_RS04765 (QQO08_04765) | 957189..957398 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
QQO08_RS04770 (QQO08_04770) | 957401..957694 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
QQO08_RS04775 (QQO08_04775) | 957782..958651 | + | 870 | WP_001002691.1 | primase alpha helix C-terminal domain-containing protein | - |
QQO08_RS04780 (QQO08_04780) | 958668..960125 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
QQO08_RS04785 (QQO08_04785) | 960427..960789 | + | 363 | WP_001039172.1 | hypothetical protein | - |
QQO08_RS04790 (QQO08_04790) | 960791..961075 | + | 285 | WP_000998180.1 | hypothetical protein | - |
QQO08_RS04795 (QQO08_04795) | 961072..961713 | + | 642 | WP_001019783.1 | hypothetical protein | - |
QQO08_RS04800 (QQO08_04800) | 962162..962503 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk / selq | 934756..964817 | 30061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T283531 WP_001103946.1 NZ_CP127024:957401-957694 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C6E6D5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | X5IA75 |