Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 940072..940549 Replicon chromosome
Accession NZ_CP127024
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-048_8421A

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag QQO08_RS04635 Protein ID WP_000052078.1
Coordinates 940072..940260 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QQO08_RS04640 Protein ID WP_001059690.1
Coordinates 940289..940549 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO08_RS04605 (QQO08_04605) 936112..936582 + 471 WP_000824472.1 hypothetical protein -
QQO08_RS04610 (QQO08_04610) 936923..937609 + 687 WP_001548082.1 thermonuclease family protein -
QQO08_RS04615 (QQO08_04615) 937966..938166 + 201 WP_001059082.1 cold-shock protein -
QQO08_RS04620 (QQO08_04620) 938663..938881 - 219 WP_000005886.1 hypothetical protein -
QQO08_RS04625 (QQO08_04625) 938943..939227 - 285 WP_001004395.1 hypothetical protein -
QQO08_RS04630 (QQO08_04630) 939315..939884 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QQO08_RS04635 (QQO08_04635) 940072..940260 - 189 WP_000052078.1 hypothetical protein Toxin
QQO08_RS04640 (QQO08_04640) 940289..940549 - 261 WP_001059690.1 hypothetical protein Antitoxin
QQO08_RS04645 (QQO08_04645) 940890..941093 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QQO08_RS04650 (QQO08_04650) 941090..941326 - 237 WP_000368687.1 hypothetical protein -
QQO08_RS04655 (QQO08_04655) 941551..942132 + 582 WP_001140686.1 histidine phosphatase family protein -
QQO08_RS04660 (QQO08_04660) 942205..942822 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
QQO08_RS04665 (QQO08_04665) 942977..943471 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QQO08_RS04670 (QQO08_04670) 943870..944292 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QQO08_RS04675 (QQO08_04675) 944440..945156 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 934756..964817 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T283530 WP_000052078.1 NZ_CP127024:c940260-940072 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT283530 WP_001059690.1 NZ_CP127024:c940549-940289 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References