Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 2056749..2057525 | Replicon | chromosome |
| Accession | NZ_CP127021 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-021_7037M | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | QQO10_RS10175 | Protein ID | WP_000031108.1 |
| Coordinates | 2056749..2056901 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | QQO10_RS10180 | Protein ID | WP_001251224.1 |
| Coordinates | 2056926..2057525 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO10_RS10160 (QQO10_10160) | 2052712..2053533 | + | 822 | WP_000669375.1 | RluA family pseudouridine synthase | - |
| QQO10_RS10165 (QQO10_10165) | 2053996..2055381 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
| QQO10_RS10170 (QQO10_10170) | 2055577..2055972 | - | 396 | WP_000901021.1 | hypothetical protein | - |
| QQO10_RS10175 (QQO10_10175) | 2056749..2056901 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| QQO10_RS10180 (QQO10_10180) | 2056926..2057525 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| QQO10_RS10185 (QQO10_10185) | 2057684..2058154 | - | 471 | WP_285236779.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| QQO10_RS10190 (QQO10_10190) | 2058159..2059286 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| QQO10_RS10195 (QQO10_10195) | 2059437..2060159 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| QQO10_RS10200 (QQO10_10200) | 2060152..2061609 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T283521 WP_000031108.1 NZ_CP127021:c2056901-2056749 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT283521 WP_001251224.1 NZ_CP127021:c2057525-2056926 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|