Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1663075..1663863 Replicon chromosome
Accession NZ_CP127021
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-021_7037M

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag QQO10_RS08195 Protein ID WP_000525004.1
Coordinates 1663402..1663863 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag QQO10_RS08190 Protein ID WP_000333630.1
Coordinates 1663075..1663389 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO10_RS08130 (QQO10_08130) 1658218..1659384 - 1167 WP_000762532.1 DUF2800 domain-containing protein -
QQO10_RS08135 (QQO10_08135) 1659381..1659743 - 363 WP_000985983.1 hypothetical protein -
QQO10_RS08140 (QQO10_08140) 1659758..1660081 - 324 WP_000175000.1 hypothetical protein -
QQO10_RS08145 (QQO10_08145) 1660160..1660321 - 162 WP_001285962.1 DUF1270 domain-containing protein -
QQO10_RS08150 (QQO10_08150) 1660333..1660596 - 264 WP_001124198.1 helix-turn-helix domain-containing protein -
QQO10_RS08155 (QQO10_08155) 1660621..1660836 - 216 WP_001097555.1 hypothetical protein -
QQO10_RS08160 (QQO10_08160) 1660891..1661256 + 366 WP_001128433.1 hypothetical protein -
QQO10_RS08165 (QQO10_08165) 1661225..1661470 - 246 WP_001025401.1 DUF2829 domain-containing protein -
QQO10_RS08170 (QQO10_08170) 1661526..1661735 + 210 WP_000642492.1 hypothetical protein -
QQO10_RS08175 (QQO10_08175) 1661725..1661868 - 144 WP_000939498.1 hypothetical protein -
QQO10_RS08180 (QQO10_08180) 1661897..1662673 - 777 WP_001148544.1 Rha family transcriptional regulator -
QQO10_RS08185 (QQO10_08185) 1662687..1662923 - 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
QQO10_RS08190 (QQO10_08190) 1663075..1663389 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
QQO10_RS08195 (QQO10_08195) 1663402..1663863 + 462 WP_000525004.1 hypothetical protein Toxin
QQO10_RS08200 (QQO10_08200) 1663933..1664466 + 534 WP_251420282.1 gas vesicle protein GvpG -
QQO10_RS08205 (QQO10_08205) 1664696..1664842 + 147 WP_001013104.1 hypothetical protein -
QQO10_RS08210 (QQO10_08210) 1664839..1665453 - 615 WP_000191459.1 hypothetical protein -
QQO10_RS08215 (QQO10_08215) 1665579..1666784 + 1206 WP_020444721.1 site-specific integrase -
QQO10_RS08220 (QQO10_08220) 1666827..1668854 - 2028 WP_001566047.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1620827..1684415 63588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T283519 WP_000525004.1 NZ_CP127021:1663402-1663863 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT283519 WP_000333630.1 NZ_CP127021:1663075-1663389 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References