283516

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 957007..957512 Replicon chromosome
Accession NZ_CP127021
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-021_7037M

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag QQO10_RS04765 Protein ID WP_001103946.1
Coordinates 957219..957512 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag QQO10_RS04760 Protein ID WP_001058492.1
Coordinates 957007..957216 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO10_RS04725 (QQO10_04725) 952524..953744 - 1221 WP_000264182.1 site-specific integrase -
QQO10_RS04730 (QQO10_04730) 953832..954560 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
QQO10_RS04735 (QQO10_04735) 954584..955312 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
QQO10_RS04740 (QQO10_04740) 955487..956221 - 735 WP_000142630.1 helix-turn-helix transcriptional regulator -
QQO10_RS04745 (QQO10_04745) 956371..956583 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
QQO10_RS04750 (QQO10_04750) 956584..956856 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
QQO10_RS04755 (QQO10_04755) 956868..957014 + 147 WP_000784885.1 hypothetical protein -
QQO10_RS04760 (QQO10_04760) 957007..957216 + 210 WP_001058492.1 hypothetical protein Antitoxin
QQO10_RS04765 (QQO10_04765) 957219..957512 + 294 WP_001103946.1 DUF1474 family protein Toxin
QQO10_RS04770 (QQO10_04770) 957600..958469 + 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
QQO10_RS04775 (QQO10_04775) 958486..959943 + 1458 WP_000432707.1 virulence-associated E family protein -
QQO10_RS04780 (QQO10_04780) 960245..960607 + 363 WP_001039172.1 hypothetical protein -
QQO10_RS04785 (QQO10_04785) 960609..960893 + 285 WP_000998180.1 hypothetical protein -
QQO10_RS04790 (QQO10_04790) 960890..961531 + 642 WP_001019783.1 hypothetical protein -
QQO10_RS04795 (QQO10_04795) 961980..962321 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 934574..964635 30061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T283516 WP_001103946.1 NZ_CP127021:957219-957512 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT283516 WP_001058492.1 NZ_CP127021:957007-957216 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References