Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1667804..1668592 Replicon chromosome
Accession NZ_CP127019
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag QQO11_RS08230 Protein ID WP_000525004.1
Coordinates 1668131..1668592 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag QQO11_RS08225 Protein ID WP_000333630.1
Coordinates 1667804..1668118 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO11_RS08165 (1662947) 1662947..1664113 - 1167 WP_000762532.1 DUF2800 domain-containing protein -
QQO11_RS08170 (1664110) 1664110..1664472 - 363 WP_000985983.1 hypothetical protein -
QQO11_RS08175 (1664487) 1664487..1664810 - 324 WP_000175000.1 hypothetical protein -
QQO11_RS08180 (1664889) 1664889..1665050 - 162 WP_001285962.1 DUF1270 domain-containing protein -
QQO11_RS08185 (1665062) 1665062..1665325 - 264 WP_001124198.1 helix-turn-helix domain-containing protein -
QQO11_RS08190 (1665350) 1665350..1665565 - 216 WP_001097555.1 hypothetical protein -
QQO11_RS08195 (1665620) 1665620..1665985 + 366 WP_001128433.1 hypothetical protein -
QQO11_RS08200 (1665954) 1665954..1666199 - 246 WP_001025401.1 DUF2829 domain-containing protein -
QQO11_RS08205 (1666255) 1666255..1666464 + 210 WP_000642492.1 hypothetical protein -
QQO11_RS08210 (1666454) 1666454..1666597 - 144 WP_000939498.1 hypothetical protein -
QQO11_RS08215 (1666626) 1666626..1667402 - 777 WP_001148544.1 Rha family transcriptional regulator -
QQO11_RS08220 (1667416) 1667416..1667652 - 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
QQO11_RS08225 (1667804) 1667804..1668118 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
QQO11_RS08230 (1668131) 1668131..1668592 + 462 WP_000525004.1 hypothetical protein Toxin
QQO11_RS08235 (1668610) 1668610..1669194 + 585 WP_000825948.1 hypothetical protein -
QQO11_RS08240 (1669424) 1669424..1669570 + 147 WP_001013104.1 hypothetical protein -
QQO11_RS08245 (1669567) 1669567..1670181 - 615 WP_000191459.1 hypothetical protein -
QQO11_RS08250 (1670307) 1670307..1671512 + 1206 WP_020444721.1 site-specific integrase -
QQO11_RS08255 (1671555) 1671555..1673582 - 2028 WP_001566047.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1625555..1689143 63588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T283499 WP_000525004.1 NZ_CP127019:1668131-1668592 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT283499 WP_000333630.1 NZ_CP127019:1667804-1668118 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References