283496

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 960293..960798 Replicon chromosome
Accession NZ_CP127019
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag QQO11_RS04785 Protein ID WP_001103946.1
Coordinates 960505..960798 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag QQO11_RS04780 Protein ID WP_001058492.1
Coordinates 960293..960502 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO11_RS04740 (955812) 955812..957032 - 1221 WP_000264182.1 site-specific integrase -
QQO11_RS04745 (957120) 957120..957848 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
QQO11_RS04750 (957872) 957872..958599 - 728 Protein_928 staphylococcal enterotoxin type Q -
QQO11_RS04755 (958774) 958774..959184 - 411 WP_285236846.1 hypothetical protein -
QQO11_RS04760 (959141) 959141..959506 - 366 WP_285236847.1 helix-turn-helix transcriptional regulator -
QQO11_RS04765 (959657) 959657..959869 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
QQO11_RS04770 (959870) 959870..960142 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
QQO11_RS04775 (960154) 960154..960300 + 147 WP_000784885.1 hypothetical protein -
QQO11_RS04780 (960293) 960293..960502 + 210 WP_001058492.1 hypothetical protein Antitoxin
QQO11_RS04785 (960505) 960505..960798 + 294 WP_001103946.1 DUF1474 family protein Toxin
QQO11_RS04790 (960886) 960886..961755 + 870 WP_001002691.1 primase alpha helix C-terminal domain-containing protein -
QQO11_RS04795 (961772) 961772..963229 + 1458 WP_000432707.1 virulence-associated E family protein -
QQO11_RS04800 (963531) 963531..963893 + 363 WP_001039172.1 hypothetical protein -
QQO11_RS04805 (963895) 963895..964179 + 285 WP_000998180.1 hypothetical protein -
QQO11_RS04810 (964176) 964176..964817 + 642 WP_001019783.1 hypothetical protein -
QQO11_RS04815 (965266) 965266..965607 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq 950456..967921 17465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T283496 WP_001103946.1 NZ_CP127019:960505-960798 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT283496 WP_001058492.1 NZ_CP127019:960293-960502 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References