Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 960293..960798 | Replicon | chromosome |
| Accession | NZ_CP127019 | ||
| Organism | Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6E6D5 |
| Locus tag | QQO11_RS04785 | Protein ID | WP_001103946.1 |
| Coordinates | 960505..960798 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IA75 |
| Locus tag | QQO11_RS04780 | Protein ID | WP_001058492.1 |
| Coordinates | 960293..960502 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQO11_RS04740 (955812) | 955812..957032 | - | 1221 | WP_000264182.1 | site-specific integrase | - |
| QQO11_RS04745 (957120) | 957120..957848 | - | 729 | WP_000733773.1 | staphylococcal enterotoxin type K | - |
| QQO11_RS04750 (957872) | 957872..958599 | - | 728 | Protein_928 | staphylococcal enterotoxin type Q | - |
| QQO11_RS04755 (958774) | 958774..959184 | - | 411 | WP_285236846.1 | hypothetical protein | - |
| QQO11_RS04760 (959141) | 959141..959506 | - | 366 | WP_285236847.1 | helix-turn-helix transcriptional regulator | - |
| QQO11_RS04765 (959657) | 959657..959869 | + | 213 | WP_001063624.1 | helix-turn-helix transcriptional regulator | - |
| QQO11_RS04770 (959870) | 959870..960142 | + | 273 | WP_001138298.1 | helix-turn-helix domain-containing protein | - |
| QQO11_RS04775 (960154) | 960154..960300 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| QQO11_RS04780 (960293) | 960293..960502 | + | 210 | WP_001058492.1 | hypothetical protein | Antitoxin |
| QQO11_RS04785 (960505) | 960505..960798 | + | 294 | WP_001103946.1 | DUF1474 family protein | Toxin |
| QQO11_RS04790 (960886) | 960886..961755 | + | 870 | WP_001002691.1 | primase alpha helix C-terminal domain-containing protein | - |
| QQO11_RS04795 (961772) | 961772..963229 | + | 1458 | WP_000432707.1 | virulence-associated E family protein | - |
| QQO11_RS04800 (963531) | 963531..963893 | + | 363 | WP_001039172.1 | hypothetical protein | - |
| QQO11_RS04805 (963895) | 963895..964179 | + | 285 | WP_000998180.1 | hypothetical protein | - |
| QQO11_RS04810 (964176) | 964176..964817 | + | 642 | WP_001019783.1 | hypothetical protein | - |
| QQO11_RS04815 (965266) | 965266..965607 | + | 342 | WP_001190616.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / selq | 950456..967921 | 17465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11590.08 Da Isoelectric Point: 4.9594
>T283496 WP_001103946.1 NZ_CP127019:960505-960798 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C6E6D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | X5IA75 |