Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 943178..943655 Replicon chromosome
Accession NZ_CP127019
Organism Staphylococcus aureus strain CC239-MRSA-III(var.) isolate Trinidad&Tobago_2020-009_371M

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag QQO11_RS04645 Protein ID WP_000052078.1
Coordinates 943178..943366 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QQO11_RS04650 Protein ID WP_001059690.1
Coordinates 943395..943655 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO11_RS04615 (939218) 939218..939688 + 471 WP_000824472.1 hypothetical protein -
QQO11_RS04620 (940029) 940029..940715 + 687 WP_285236845.1 thermonuclease family protein -
QQO11_RS04625 (941072) 941072..941272 + 201 WP_001059082.1 cold-shock protein -
QQO11_RS04630 (941769) 941769..941987 - 219 WP_000005886.1 hypothetical protein -
QQO11_RS04635 (942049) 942049..942333 - 285 WP_001004395.1 hypothetical protein -
QQO11_RS04640 (942421) 942421..942990 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QQO11_RS04645 (943178) 943178..943366 - 189 WP_000052078.1 hypothetical protein Toxin
QQO11_RS04650 (943395) 943395..943655 - 261 WP_001059690.1 hypothetical protein Antitoxin
QQO11_RS04655 (943996) 943996..944199 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QQO11_RS04660 (944196) 944196..944432 - 237 WP_000368687.1 hypothetical protein -
QQO11_RS04665 (944657) 944657..945238 + 582 WP_001140686.1 histidine phosphatase family protein -
QQO11_RS04670 (945311) 945311..945928 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
QQO11_RS04675 (946083) 946083..946577 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QQO11_RS04680 (946976) 946976..947398 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QQO11_RS04685 (947546) 947546..948262 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T283495 WP_000052078.1 NZ_CP127019:c943366-943178 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT283495 WP_001059690.1 NZ_CP127019:c943655-943395 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References