Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 814084..814561 Replicon chromosome
Accession NZ_CP127017
Organism Staphylococcus aureus strain CC8-MSSA (PVL+) isolate Trinidad&Tobago_2020-042_7641M

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag QQO09_RS03880 Protein ID WP_000052078.1
Coordinates 814084..814272 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag QQO09_RS03885 Protein ID WP_001059690.1
Coordinates 814301..814561 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQO09_RS03850 (810125) 810125..810595 + 471 WP_000824472.1 hypothetical protein -
QQO09_RS03855 (810936) 810936..811622 + 687 WP_001548082.1 thermonuclease family protein -
QQO09_RS03860 (811979) 811979..812179 + 201 WP_001059082.1 cold-shock protein -
QQO09_RS03865 (812675) 812675..812893 - 219 WP_000005886.1 hypothetical protein -
QQO09_RS03870 (812955) 812955..813239 - 285 WP_001004395.1 hypothetical protein -
QQO09_RS03875 (813327) 813327..813896 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
QQO09_RS03880 (814084) 814084..814272 - 189 WP_000052078.1 hypothetical protein Toxin
QQO09_RS03885 (814301) 814301..814561 - 261 WP_001059690.1 hypothetical protein Antitoxin
QQO09_RS03890 (814902) 814902..815105 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
QQO09_RS03895 (815102) 815102..815338 - 237 WP_000368687.1 hypothetical protein -
QQO09_RS03900 (815563) 815563..816144 + 582 WP_001140686.1 histidine phosphatase family protein -
QQO09_RS03905 (816217) 816217..816834 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
QQO09_RS03910 (816989) 816989..817483 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
QQO09_RS03915 (817882) 817882..818304 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
QQO09_RS03920 (818452) 818452..819168 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T283484 WP_000052078.1 NZ_CP127017:c814272-814084 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT283484 WP_001059690.1 NZ_CP127017:c814561-814301 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References