Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4080793..4081396 | Replicon | chromosome |
Accession | NZ_CP126994 | ||
Organism | Acidisoma sp. PAMC 29798 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QP803_RS19630 | Protein ID | WP_284947970.1 |
Coordinates | 4081091..4081396 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | QP803_RS19625 | Protein ID | WP_284945151.1 |
Coordinates | 4080793..4081098 (-) | Length | 102 a.a. |
Genomic Context
Location: 4077880..4078968 (1089 bp)
Type: Others
Protein ID: WP_284945148.1
Type: Others
Protein ID: WP_284945148.1
Location: 4079314..4080021 (708 bp)
Type: Others
Protein ID: WP_284945149.1
Type: Others
Protein ID: WP_284945149.1
Location: 4081844..4082329 (486 bp)
Type: Others
Protein ID: WP_284945152.1
Type: Others
Protein ID: WP_284945152.1
Location: 4083270..4083905 (636 bp)
Type: Others
Protein ID: Protein_3883
Type: Others
Protein ID: Protein_3883
Location: 4085566..4085991 (426 bp)
Type: Others
Protein ID: WP_284945156.1
Type: Others
Protein ID: WP_284945156.1
Location: 4075806..4076120 (315 bp)
Type: Others
Protein ID: WP_284945145.1
Type: Others
Protein ID: WP_284945145.1
Location: 4076514..4077680 (1167 bp)
Type: Others
Protein ID: WP_284945146.1
Type: Others
Protein ID: WP_284945146.1
Location: 4077702..4077881 (180 bp)
Type: Others
Protein ID: WP_284945147.1
Type: Others
Protein ID: WP_284945147.1
Location: 4080080..4080724 (645 bp)
Type: Others
Protein ID: WP_284945150.1
Type: Others
Protein ID: WP_284945150.1
Location: 4080793..4081098 (306 bp)
Type: Antitoxin
Protein ID: WP_284945151.1
Type: Antitoxin
Protein ID: WP_284945151.1
Location: 4081091..4081396 (306 bp)
Type: Toxin
Protein ID: WP_284947970.1
Type: Toxin
Protein ID: WP_284947970.1
Location: 4082355..4083146 (792 bp)
Type: Others
Protein ID: WP_284945153.1
Type: Others
Protein ID: WP_284945153.1
Location: 4084567..4084773 (207 bp)
Type: Others
Protein ID: WP_284945154.1
Type: Others
Protein ID: WP_284945154.1
Location: 4084845..4085417 (573 bp)
Type: Others
Protein ID: WP_284945155.1
Type: Others
Protein ID: WP_284945155.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP803_RS19595 | 4075806..4076120 | - | 315 | WP_284945145.1 | WGR domain-containing protein | - |
QP803_RS19600 | 4076514..4077680 | - | 1167 | WP_284945146.1 | ISKra4 family transposase | - |
QP803_RS19605 | 4077702..4077881 | - | 180 | WP_284945147.1 | hypothetical protein | - |
QP803_RS19610 | 4077880..4078968 | + | 1089 | WP_284945148.1 | IS66 family transposase | - |
QP803_RS19615 | 4079314..4080021 | + | 708 | WP_284945149.1 | IS6 family transposase | - |
QP803_RS19620 | 4080080..4080724 | - | 645 | WP_284945150.1 | hypothetical protein | - |
QP803_RS19625 | 4080793..4081098 | - | 306 | WP_284945151.1 | putative addiction module antidote protein | Antitoxin |
QP803_RS19630 | 4081091..4081396 | - | 306 | WP_284947970.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP803_RS19635 | 4081844..4082329 | + | 486 | WP_284945152.1 | IS6 family transposase | - |
QP803_RS19640 | 4082355..4083146 | - | 792 | WP_284945153.1 | IS6 family transposase | - |
QP803_RS19645 | 4083270..4083905 | + | 636 | Protein_3883 | IS5 family transposase | - |
QP803_RS19650 | 4084567..4084773 | - | 207 | WP_284945154.1 | hypothetical protein | - |
QP803_RS19655 | 4084845..4085417 | - | 573 | WP_284945155.1 | hypothetical protein | - |
QP803_RS19660 | 4085566..4085991 | + | 426 | WP_284945156.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4072743..4083905 | 11162 | |
- | flank | IS/Tn | - | - | 4083225..4083905 | 680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11267.97 Da Isoelectric Point: 9.8903
>T283483 WP_284947970.1 NZ_CP126994:c4081396-4081091 [Acidisoma sp. PAMC 29798]
VIELKQTETFIKWEGRLRDKRAKTMIAARLARLAHGLPGDVESVGEGVSELRIHYGPGYRVYFQQRGAVLIVLLCGGDKK
TQARDIVTAKKLANEWSDTDG
VIELKQTETFIKWEGRLRDKRAKTMIAARLARLAHGLPGDVESVGEGVSELRIHYGPGYRVYFQQRGAVLIVLLCGGDKK
TQARDIVTAKKLANEWSDTDG
Download Length: 306 bp