Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 2683865..2684486 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | QP803_RS12975 | Protein ID | WP_284943892.1 |
| Coordinates | 2684157..2684486 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | QP803_RS12970 | Protein ID | WP_284943891.1 |
| Coordinates | 2683865..2684176 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS12960 | 2679235..2681337 | - | 2103 | WP_284943890.1 | protein-disulfide reductase DsbD family protein | - |
| QP803_RS12965 | 2681419..2683857 | + | 2439 | WP_284947908.1 | ATP-dependent helicase HrpB | - |
| QP803_RS12970 | 2683865..2684176 | - | 312 | WP_284943891.1 | BrnA antitoxin family protein | Antitoxin |
| QP803_RS12975 | 2684157..2684486 | - | 330 | WP_284943892.1 | BrnT family toxin | Toxin |
| QP803_RS12980 | 2684584..2685687 | + | 1104 | WP_284943893.1 | NAD-binding protein | - |
| QP803_RS12985 | 2685745..2686521 | - | 777 | WP_284943894.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| QP803_RS12990 | 2686715..2687770 | + | 1056 | WP_284943895.1 | dTDP-glucose 4,6-dehydratase | - |
| QP803_RS12995 | 2687814..2688698 | + | 885 | WP_284943896.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| QP803_RS13000 | 2688711..2689271 | + | 561 | WP_284943897.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12713.66 Da Isoelectric Point: 8.6044
>T283482 WP_284943892.1 NZ_CP126994:c2684486-2684157 [Acidisoma sp. PAMC 29798]
MDWFYKFVVTRAVNVRVEWDPVKADQNLRKHRVSFALAMRVFFDPLALVEQDRVEGGEERWQTLGMVDGVTLLLVAHTML
DGGAIEVIRIISARRAEPKERRNYEQAQR
MDWFYKFVVTRAVNVRVEWDPVKADQNLRKHRVSFALAMRVFFDPLALVEQDRVEGGEERWQTLGMVDGVTLLLVAHTML
DGGAIEVIRIISARRAEPKERRNYEQAQR
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|