Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 2600015..2600562 | Replicon | chromosome |
Accession | NZ_CP126994 | ||
Organism | Acidisoma sp. PAMC 29798 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QP803_RS12610 | Protein ID | WP_284947902.1 |
Coordinates | 2600236..2600562 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QP803_RS12605 | Protein ID | WP_284943826.1 |
Coordinates | 2600015..2600239 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP803_RS12585 | 2595310..2596155 | - | 846 | WP_284947901.1 | undecaprenyl-diphosphate phosphatase | - |
QP803_RS12590 | 2596237..2597505 | + | 1269 | WP_284943823.1 | transcription antitermination factor NusB | - |
QP803_RS12595 | 2597651..2597848 | + | 198 | WP_284943824.1 | hypothetical protein | - |
QP803_RS12600 | 2598060..2599889 | + | 1830 | WP_284943825.1 | translational GTPase TypA | - |
QP803_RS12605 | 2600015..2600239 | + | 225 | WP_284943826.1 | antitoxin MazE family protein | Antitoxin |
QP803_RS12610 | 2600236..2600562 | + | 327 | WP_284947902.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QP803_RS12615 | 2600617..2601921 | + | 1305 | WP_284943827.1 | MFS transporter | - |
QP803_RS12620 | 2601926..2602639 | + | 714 | WP_284943828.1 | CoA transferase subunit A | - |
QP803_RS12625 | 2602651..2603301 | + | 651 | WP_284943829.1 | CoA transferase subunit B | - |
QP803_RS12630 | 2603298..2604518 | - | 1221 | WP_284943830.1 | MFS transporter | - |
QP803_RS12635 | 2604686..2605348 | - | 663 | WP_284943831.1 | glutathione S-transferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11622.51 Da Isoelectric Point: 8.0808
>T283481 WP_284947902.1 NZ_CP126994:2600236-2600562 [Acidisoma sp. PAMC 29798]
IVRGDLLTVAVHGDFGKHRPALVIQADQFSEHTTVTVLPLSSSMVDAPLLRITVQPSTENGLRAPSQVMIDKATTIKREK
AGSAFGRIETATLVEIERCLAVFLGIAK
IVRGDLLTVAVHGDFGKHRPALVIQADQFSEHTTVTVLPLSSSMVDAPLLRITVQPSTENGLRAPSQVMIDKATTIKREK
AGSAFGRIETATLVEIERCLAVFLGIAK
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|