Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpA-brnA/BrnT-BrnA |
Location | 2097615..2098161 | Replicon | chromosome |
Accession | NZ_CP126994 | ||
Organism | Acidisoma sp. PAMC 29798 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | QP803_RS10120 | Protein ID | WP_284947635.1 |
Coordinates | 2097877..2098161 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | - |
Locus tag | QP803_RS10115 | Protein ID | WP_284947634.1 |
Coordinates | 2097615..2097890 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP803_RS10090 | 2093090..2093287 | + | 198 | WP_284947629.1 | YqaE/Pmp3 family membrane protein | - |
QP803_RS10095 | 2093284..2093574 | + | 291 | WP_284947630.1 | putative quinol monooxygenase | - |
QP803_RS10100 | 2093611..2094912 | - | 1302 | WP_284947631.1 | glycolate oxidase subunit GlcF | - |
QP803_RS10105 | 2094921..2096114 | - | 1194 | WP_284947632.1 | FAD-binding protein | - |
QP803_RS10110 | 2096111..2097547 | - | 1437 | WP_284947633.1 | FAD-linked oxidase C-terminal domain-containing protein | - |
QP803_RS10115 | 2097615..2097890 | - | 276 | WP_284947634.1 | BrnA antitoxin family protein | Antitoxin |
QP803_RS10120 | 2097877..2098161 | - | 285 | WP_284947635.1 | BrnT family toxin | Toxin |
QP803_RS10125 | 2098289..2099527 | + | 1239 | WP_284947636.1 | DNA topoisomerase IB | - |
QP803_RS10130 | 2099561..2099737 | - | 177 | WP_284947637.1 | DUF3309 domain-containing protein | - |
QP803_RS10135 | 2099838..2100548 | - | 711 | WP_284947638.1 | methyltransferase domain-containing protein | - |
QP803_RS10140 | 2100639..2101370 | + | 732 | WP_284947639.1 | hydroxyacylglutathione hydrolase | - |
QP803_RS10145 | 2101409..2102005 | + | 597 | WP_284947640.1 | glutathione S-transferase N-terminal domain-containing protein | - |
QP803_RS10150 | 2102011..2102454 | + | 444 | WP_284947641.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10747.10 Da Isoelectric Point: 6.4863
>T283479 WP_284947635.1 NZ_CP126994:c2098161-2097877 [Acidisoma sp. PAMC 29798]
VPRFTWNAAKARSNLLKHGVAFEDAELVWRDPRHLLRFDRIEDGEERWHAIGLAGSVVVLLVAHTDTEDGDIIRLLSARR
ATKAERKAYENDDV
VPRFTWNAAKARSNLLKHGVAFEDAELVWRDPRHLLRFDRIEDGEERWHAIGLAGSVVVLLVAHTDTEDGDIIRLLSARR
ATKAERKAYENDDV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|